KEGG   Coprinopsis cinerea: CC1G_14217Help
Entry
CC1G_14217        CDS       T01275                                 

Definition
RAD54B protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cci  Coprinopsis cinerea
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cci03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1055 aa AA seqDB search
MPPYSSLVPAKRRNDDDVDGPNRKRPSLDAEPSYGNTRKQYWMIQWRNPQARKHKTWEGD
GVLVGEPGGRGTLYDSEGKIIATGKVDSNLSEGTNFHIGGKDIELDRAITQGEYFSGACF
GRGTSAFTAQQTVPAVPVRKQAKFIPPQRAANISSSSTDALTTGNKSNIPPNSEKEVVPS
KCHWAVNWRKQQTRKHKTWDGDGFVSLMGDQLRMVTEDGKLMGTTKWKGGELYSGLRVFI
NNKEVELDRDVPSSQVPKAKGQPLSQEEDLITEPSPPPTIAKPSTGIAASSFYGAPKAKQ
PKGPLHDPNAPGAVVFKAPNKAHMQRYNKYDLPVVPVVLDPILARRMRPHQIEGTVICVS
FMYECVMGLRKHEGNGCILADEMGLGKTLQTIALVWTLLKQNPYSGAGPIAKKALIVCPV
SLITNWKAEFHKWLGRDRVGITVVDKEKVNIDAFFYNKTQHVLIIGYERLRTVINKVSTS
VPPIDLIICDEGHRLKSANNKTTAMFKALRTRRRIILSGTPIQNDLSEFHAMTEFCNPGL
LDEYPVFKRVYETPILKSRAPEATAKEIEVGEARTESLLQVANSFVLRRDATLLKKHLPP
KRRCIAYIRMDQYLIPFPDEYVVFVTPTRLQISMFSAILRPERIDDLASGSTAESLALIN
ILTKISNSPILLKATADSYKARTGDKESSCLERAGVKEALRLMPEGAQVSDMTLSGKLIV
LAKMLKDIRNNTEEKCVVVSHFTSTLNILEAFCQQAGYSFYRLDGQTPQQKRQEYVNAFN
KSSQRGGFVFLLSSKAGGVGINLIGGSRLFLIDSDWNPSHDLQAMARCHRDGQKRPVFIY
RLVTAGTIDEKIFQRQITKLGLSASLIGSADGSASKSDSFSKKDLRDIFRIDPNTSCNTH
DLLECPCDGSVIPVPGSSSTDDNGERVARLKRGFQSASSVTMAEVDEEFLDKKKAGLASL
SEWKHINCLKPSADRPALDEVIQAVLPECDSGFKSYDSITGSSRAERLLKAVDLDNIQAM
EKTFNVADFPGGTISFLFEKSTESTIASEGSDVEA
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatacagttccttagtcccggcgaagaggaggaacgacgacgatgtggatgga
ccaaatcgtaaacgaccgtctcttgacgcagaaccttcgtatggcaacacaagaaagcag
tattggatgattcaatggcgaaatccacaagcaaggaagcataaaacctgggaaggagat
ggggtccttgttggtgaaccagggggaagaggaaccctttacgactctgagggcaaaata
atcgcgaccggaaaggtcgactcgaatctttcggaaggcacaaacttccacattggtggt
aaagatattgaacttgaccgtgctatcactcaaggagaatacttctctggagcatgtttt
ggcagaggaacttctgccttcaccgcccaacaaaccgtgcccgctgtgccagtcaggaaa
caagcaaagtttataccacctcagagggctgcgaatatctcctcctcctcaacagatgcc
ctcacgactggaaacaaatccaatataccgcccaactctgagaaggaagttgtaccatct
aaatgtcactgggcagtaaattggcggaagcaacagactcgcaagcataagacatgggat
ggcgatggcttcgtttcactcatgggggatcaattgaggatggtaaccgaggatggaaag
ctcatgggcacaacaaaatggaaaggaggagaactctactcaggtctaagagtatttatc
aataacaaagaggttgaacttgatcgagacgtcccaagctcgcaagtcccaaaggccaaa
ggacaaccactgtcgcaggaggaggatctcatcaccgaaccctctcctccacccactatc
gccaagccttcgaccggtatcgcggcgtcctcgttctatggcgctcccaaagcaaagcag
ccaaagggacccttacacgatcccaatgcacctggtgcagtggtattcaaagctccgaac
aaagcgcatatgcaacgatacaacaaatatgaccttcctgtcgttcctgtcgtcctggat
cctatccttgcaagacggatgcgaccccatcagattgaaggcacggtcatctgcgtatcg
tttatgtacgaatgtgtaatgggtctccgcaagcatgaaggtaacggctgcatcttggct
gacgaaatgggtctcggaaagactttgcagacgattgcacttgtgtggacgctgctaaaa
cagaatccttactcgggcgcgggacctatcgcgaagaaggccttaattgtctgccccgtg
tctctcatcaccaattggaaggcagaattccacaaatggctgggcagggacagggttggg
attaccgtcgtcgacaaggagaaagtcaacatcgacgccttcttctacaataaaacccaa
catgtcctcatcatcggttatgagcgactcagaactgttataaacaaagtgtcaacctcc
gttccaccgattgacctcatcatttgcgatgaggggcacaggctgaaatctgctaacaac
aagacaacagccatgttcaaagccctcagaacccgtcgacgcattatcctttccggtaca
ccgatccagaacgacctcagtgaattccatgccatgaccgagttctgcaatcccggcctg
ctcgatgagtaccccgtcttcaaacgcgtgtacgaaacccccattctgaagagccgcgcc
cctgaggctacggcgaaagaaatagaggtcggagaagcgcgtactgagagcttactccaa
gtggccaacagttttgtccttcgaagagacgccacgctcctgaaaaaacacctgcctccg
aaacgtcggtgcatcgcatacatccgcatggaccagtacttaatcccattcccagatgaa
tacgtcgtcttcgtgactccaacgaggcttcagatatccatgttttcagcaattctaagg
ccggaaagaatagacgatctggcgtccggctcgactgcagaatctctggcgctcatcaac
attctaactaagatcagcaacagccctatccttctgaaagcgacggcagattcttacaag
gcgaggactggcgacaaagaatcgtcgtgtcttgaacgggcgggcgtaaaggaggctttg
cggttaatgccggaaggagcacaagtttctgacatgacgctgagtgggaagttgatcgta
ttggcgaagatgctcaaggatatacggaataacactgaggagaaatgcgtcgtcgtctcc
catttcacatcaacattgaacatcctcgaagccttttgtcaacaagcggggtattcgttt
tatcgacttgatggccagactcctcagcagaagcgccaggagtacgtcaacgcgttcaac
aaatcttcccagagaggaggcttcgtctttctcttaagctctaaagcaggtggcgttggt
atcaacttaattggcggctcgaggcttttccttatcgactcggactggaacccaagtcac
gacctacaagcgatggctcgctgccaccgggacggccaaaaacgcccagtgtttatctat
cgattggttactgcgggcacgatcgatgagaaaatctttcagcggcagatcaccaagctt
ggtctcagtgcatcactcattggatcagccgatggcagcgcgtccaaaagtgactcgttc
tcaaagaaagatttgcgggatatcttccgtatagatcccaacacaagttgcaacacgcac
gaccttctcgagtgcccgtgcgacggctctgtcatccctgtccctggatcttcatccaca
gacgataatggagaacgagttgcgagactcaaacggggtttccaatcagcctcatccgtc
accatggctgaagtcgatgaggagttcttggacaagaagaaagcggggctagcctcgctc
agcgaatggaaacacattaactgtctcaaaccgtcggctgaccgaccggcactggacgaa
gtcattcaagccgtccttcccgaatgtgattctggcttcaaatcgtatgacagcatcaca
gggtcctcaagagccgagagacttttgaaagcagtggacctggacaatatccaggctatg
gagaagaccttcaacgtcgcggatttccctggtgggacaatttcgttccttttcgagaag
agcaccgaaagcacaattgcatccgaaggctctgacgtagaggcataa

DBGET integrated database retrieval system