KEGG   Coprinopsis cinerea: CC1G_14241Help
Entry
CC1G_14241        CDS       T01275                                 

Definition
STE/STE7 protein kinase
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cci  Coprinopsis cinerea
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cci04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 593 aa AA seqDB search
MASNHNNRFPTSTPIPPSLQAKLAAFQANRAAPTNNAVRSLEDAMNGVSIAPPAVPPPPL
KPGPSLAARMQALRGQSTPGRRPKPAFSLHDIDPSLGGISDAGLGAGRPRPPLSLHSAAK
PPAFATPFANFSKIVDPSGALNFSGKAILHASGVNFENGSSFAINRDQLQLDDEELGRGN
YGTVKKVLHKPTNVAMAMKEIRDSIQANSPAIIMELDVLHRAVAPEIVEFYGAFFIESCV
YYCMEYMDAGSLDKLIQSNSQPPQPQIPKPPSSDPIQTDASSPEYSFAMPFVEEDLDLTK
DENFEPYNRAFNRTCPPPIPSTYSGGPIPEAILGRIAASMVRGLKFLKDELNIIHRDVKP
TNVLVNCKGQVKLCDFGVSGQLDKSMAKTNIGCQSYMAPERIRGESRVVGAVPASEGGTG
TAAAAQGGVPGTAALADELYGAYTVSSDVWSLGLSIIELGLGRYPYPPETYSNVFAQLTA
IVHGPPPCLPSGPPPPLSPDDDSSFEEPVLPPTLDDQDPLISPTTGRQRPGYSPFARDWV
NKCMRKDAKERATYKELLEHPWLIRNGQVDVDMEGWVRCALDAKERAKAGRGR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaccataacaaccgatttccgacttcaacaccgattcctcccagtcttcag
gcaaagctcgctgctttccaggcaaaccgcgccgcaccaacaaataatgcagtccgttct
ctcgaagatgccatgaacggcgtctccattgctcctcccgccgtcccaccgcccccgctc
aagccagggcccagtctcgccgcccggatgcaggccctccgaggccagtccactcccggc
cgtcgtccaaaacccgccttctctcttcacgacatcgatccatccctcggcggcatatcg
gacgcaggtctcggcgcaggccgcccccgccctcccctctccctccactctgccgccaaa
ccaccagcctttgctactccctttgcaaacttttcaaagatcgtcgatccctctggcgct
ctcaactttagcggaaaagctatccttcacgctagcggcgtcaactttgagaacggctca
agctttgcgattaatagggatcagctccagctcgacgacgaggagctcggaagaggcaac
tatggcacagtcaagaaagtcctacacaagccaacaaacgtcgcaatggctatgaaggaa
atcagagactcgatccaggcaaactcaccagcaatcatcatggaactcgacgtcctccac
cgcgcagtcgcaccagaaatcgtcgaattctacggcgcatttttcatcgaaagctgtgtc
tactactgtatggaatacatggacgccggctctctagataaactcatccaatccaactca
caaccaccccagcctcaaatccccaaaccaccgtcctcggaccccatccagacagacgct
tcgtcgccagaatactctttcgcgatgcctttcgttgaggaggacctcgatttgaccaag
gatgaaaactttgaaccctacaaccgcgccttcaaccgtacctgtccccctccaataccc
agcacctactctggcggccccatccccgaagccatcctcggccgtatcgcagcctccatg
gtccgtggtctcaaattcctcaaagacgaactcaatatcattcaccgcgacgtcaaaccg
accaacgtgctcgtcaattgcaaaggccaagtcaaactttgtgatttcggtgtgagcggt
cagctcgacaagagtatggccaagacaaacatcggatgccagagctacatggctcctgag
cgcattcgtggagaaagcagggtcgttggtgcagtccctgcctcagaaggtgggacaggt
actgcggccgccgctcagggtggtgtaccgggcacagcggcattggcggacgagctctat
ggggcgtacactgtttccagtgatgtgtggagtctggggctgtcgattattgagctgggg
ctggggaggtatccttaccctccggaaacttactcaaatgtctttgctcagctgacggcg
attgtccatggcccgccaccttgtttgccgagcggtccccctcctcccttatcccccgac
gatgattcctcgtttgaagaacccgtcctaccacccacgttggatgatcaagaccccctg
atttcacccacgacgggtaggcagaggccagggtattcaccattcgcccgcgattgggtg
aacaagtgcatgaggaaggatgcaaaggagcgggcaacatacaaagagctcttggaacac
ccatggttgattcgcaacggccaggtcgacgtcgacatggagggttgggtcaggtgcgcc
ctcgacgcaaaggagagagccaaagctgggcgggggaggtaa

DBGET integrated database retrieval system