KEGG   Coprinopsis cinerea: CC1G_14245Help
Entry
CC1G_14245        CDS       T01275                                 

Definition
CMGC/DYRK/YAK protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CC1G_14245
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   CC1G_14245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1065 aa AA seqDB search
MQDSNESSFDLPRWQTHVEPAAQATPYLYGPPPPSQHSMSGSSPQRIQPVHQSHTGSSTR
QPRISQLLEQEHSLSPPSNQYTPSNQAPLSRSASLGGTSASNLASRLVRRHNQPDDLEAY
NTDNQGLSGPRQQPQLSQNTFYNPSVGYQSPSMTGNVSSGTTAGSTSDSYSDLYYNGSAS
QPPKRIQDPNRAAGRSPHRAANPTNSTGLIDAYAQQQSQYSPTTATYSYGPGPPQSTGYQ
THGRSNSQVKQEQATPPIASPYAPQNQSHQPLRQLTTNIVETYRICNPSYRYESAHNPRR
VLTKPSKPVHNEGYDNEDYDYILYVNDWLGTEEGHKYLILDILGQGTFGQVVKCQNMKTH
EIVAVKVIKNKPAYFNQSMMEVTILEMLNKTCDPNDEHHLLRLRDSFIHRSHLCLVFELL
SSNLYELIKQNQFQGLSTQLVKVFMAQLLDALTVLKEARLIHCDLKPENILLKSLQSPQI
KVIDFGSACHERQTVYTYIQSRFYRSPEVLLGMPYTAAIDMWSLGCIAVELFLGLPLFPG
TSEYNQLTRIIEMLGMPPLSMLNSGKQTKLNNRAAFIDFCKGLLDLNPVTRWTPQQARLH
PFITGEKFTKPFVPEGLAPSQPSSSSSPNTPDPKRPYGGLVPSQPKGTRAYQDAATYNHH
LAQHQAYTAQQASQAANTFRNPYINPPAQQQQSQQQHQQQPPSQPPVAQTTYTNPPADPY
HPQSQQQQSQSQHLSGQYGSGAAQTAHRALAHANSANQLGSGASGSQYPSHSSATNLSSS
HLNPNVSSGSYYPNSRARANTINQMDTIPPALARLQHMNQDIIGGRNALTPVLNRDDAMK
EWERRQSGKPPAAQPYPQLEYLQQQAEIVAASGLANWASGPHTRYPAQPSKLQHSYQPHT
IMVDDENGNTSRRDVVMSNVRAAAGGGARTDQQSGLGSYSGSTGNLITSPPQAYSGNTAA
GSRYTTSYGQPQHPPPPASSNSFDTVDRRTDIGMYVPMQPDQYQGYPASTSTNRHAPPAG
PPVPTSFYGPSIVPSGSQQQRNPFNVQENAQQSMGQPKDNRNWPR
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactctaacgaatcgtcgttcgaccttcctcgttggcagacccatgtcgagcct
gcagcccaggcaactccctacctttatggcccaccgccgccttcacagcattccatgtcc
ggatcgtcaccccaacgcatccagccagtccaccagagccacacaggttcttcaaccagg
cagccacgaatttctcagttgctcgagcaggaacactcattaagcccgccatccaaccag
tatacaccctcaaaccaggccccattgtcccgcagtgcatcccttggaggtaccagcgca
agtaacctggcttcgcgccttgtcaggcgccataatcaaccggacgatttggaagcctac
aatactgacaaccaaggactatcgggaccccgtcagcaaccccaactctcccaaaacacg
ttttacaaccccagtgttgggtatcagtcaccatcgatgacagggaacgtttcatctggc
acgacagcaggctcaacatccgattcctactcagatctctactacaatggttcagccagt
caaccaccaaagagaatccaagatcccaaccgtgccgccggtcgatcgccacaccgagcc
gccaatcctaccaattcaacgggactcatagacgcttacgctcaacagcaatcgcaatac
tctccgacaacagcaacgtactcgtacggtcctggtcccccacaatcgactggttatcag
acccacggtcgcagcaactcccaggtcaagcaagagcaagcgacaccccctatagcaagc
ccttatgcaccccagaatcagtcccaccaacctttgcggcaactcactacaaacatcgtc
gagacataccggatttgcaaccccagctatcgctatgaatcggctcataaccccagacgg
gttctcaccaagccgagcaaacccgttcacaatgaagggtacgacaacgaggattatgat
tacattctctacgtcaatgattggctgggtactgaagagggccacaaataccttatcctt
gatattctcggtcaaggaacgttcggccaggtggtgaaatgccagaacatgaagacacac
gagattgtcgccgtgaaagtgatcaagaacaagcccgcgtactttaaccagagtatgatg
gaggtcacgatcctagagatgcttaacaaaacctgcgatccaaacgacgaacaccacctt
cttcgacttcgcgattcattcatccatcgaagtcacctgtgcctcgtctttgagcttctg
tcgtccaacctttacgagttgatcaagcagaatcaattccagggtctgagtacgcaactt
gtcaaggtcttcatggcccagcttctcgacgccttgaccgtattgaaagaggcacggttg
atacactgcgatttgaagcctgaaaacatcctattgaaatcccttcaatctcctcaaatc
aaagttatcgacttcggttctgcgtgtcatgaacggcaaacagtctacacctacattcag
tcgcgattctatcgctcacctgaagtccttttgggaatgccttacacggcagctatcgac
atgtggtcattgggctgcattgccgtcgagctattccttggtctacctcttttccctggt
accagcgagtacaaccagctaacgaggataattgagatgctagggatgcctcctttgagc
atgctcaatagcggcaagcaaaccaaactcaataaccgtgctgcgttcatcgacttctgc
aaaggcctcttggatctgaaccctgtgacacgatggactccacagcaagcgcgactccac
ccattcatcaccggagaaaagtttacaaaacccttcgtccccgaaggtctggcaccttca
caaccctcttcttcttcgtccccgaacacccccgatcccaagcgtccatacggcggtctc
gttccgtctcagccgaagggcacgcgggcttatcaggacgcggccacttacaaccatcat
ctcgctcagcaccaggcatataccgcccagcaggcgtcgcaggctgcgaacactttccga
aacccgtacatcaatccaccggctcagcaacagcaatcgcagcaacaacatcaacaacag
ccaccatcccaaccccctgtagcacaaacgacctatacaaaccctcctgcggacccgtac
caccctcagtcgcaacagcaacagtctcagtcacagcatctctccggccagtatggaagt
ggagcggcacaaactgctcaccgtgcccttgcacacgcgaactctgcgaatcaattgggt
tctggagcatctgggtcacaatatccctcccattcgtccgccacaaacctctcgtcttcg
catctaaacccgaatgtgtcgtctggttcttactaccccaattctcgcgctcgggccaac
acgatcaaccagatggataccattccacctgctctcgctcgactgcaacacatgaaccaa
gacataatcggtggacgaaatgcattgacgccggtcttgaaccgtgatgacgccatgaaa
gaatgggagcgacgccaatctggcaaacctcctgctgctcaaccgtacccgcaattggag
tacctgcagcagcaggcggagatcgtagctgcgtctggcttggccaactgggcgagtggt
cctcatacaaggtacccggcgcaaccgtcaaagttgcaacactcgtaccaacctcatacg
attatggttgacgatgagaacgggaatacctctaggagggatgtggtgatgtccaatgtt
cgcgcagctgctggtggtggtgcacgaaccgaccagcaatcggggcttggctcatacagc
gggagcactggaaacctcattacgagtccaccacaagcttactccggtaacaccgcggca
ggaagtcggtacacgacaagctatgggcaaccacagcacccgccaccgccagcatcttcc
aactcgttcgacacggtagatcggcggacggatatcgggatgtacgtgcctatgcagccg
gatcagtaccaaggctatcctgcttcgacttcgacgaacaggcacgctcctccggctgga
ccgccggttccgacatcgttctacggaccttcgatcgttccttcaggatcccaacaacag
aggaacccgttcaacgtgcaggagaacgcgcagcagtctatgggtcaacctaaggacaac
cgcaactggccccgataa

DBGET integrated database retrieval system