KEGG   Coprinopsis cinerea: CC1G_14471Help
Entry
CC1G_14471        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CC1G_14471
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_14471
Transcription machinery [BR:cci03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CC1G_14471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 589 aa AA seqDB search
MEEVCMESVIDAEEKQTRFQVSHKLREPYKKWTEDEKDKAAMEGFTRLPCQARRGLVNLG
QTCFLNAVLQCLVHNPLLRNYFLSDKHNWRQCKLEHCACCEMDKLFTEIYSIPTPPPSTN
TPANSTPLTLSSSLNPPPLPSQHPHPTQPGPHAPHTFLHTLYKTSPDLSSYAQHDAHETF
ISLLNLIHSTTRGSTNVSCNCVIHGVFGGQLQSDVRCERCGNTTTAIDPMLDVSLEIGRA
GGSKGGPKAAEELTLAGCLRRFTTSEKLGLKEYTCTKCNKVTTDASKRMSIRQLPAVLSF
QFKVRFIAGVIPPPPSLLFIFKFFISRPPSNHTSAPLLKQRFEQRTNDKSSARKLDTPVR
IPASINMAPYTSAVLKEMDKENSAGGGVGAGVPFIYPGPEAIYEYDLFAVINHEGQIDNG
HYTNYARFEDEWYRFDDDKVTHSSLGQCLSSNPYMCFYVKRHLDYKPYMTPSYTVLMQKQ
EREREAREAREREMSGGSVGASGSGRERDKDRDRDRDRDRDRDSRDERDARASRDRDARD
GRDRDRDRDRDSRDGRDGKDGGKGYSKREMPPEEDDIMKEIDDALLATV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtgtgtatggagagtgtgattgatgctgaggagaagcagacgaggttccag
gtatctcataaattgcgggaaccgtacaagaagtggacagaggatgagaaggacaaggct
gctatggagggatttacgcggttaccttgccaggcccgccgcggcctagtcaacctcgga
caaacctgcttcctcaatgccgtcctccaatgtctagtccacaaccccctcctccgcaac
tacttcctcagcgacaaacacaactggcgccaatgtaaactcgagcactgtgcatgttgc
gagatggataaactctttaccgagatctattctatacctacgcctccaccgtccaccaac
acccctgcaaactccacacctcttacgctctcatcctcgctcaacccaccacctttgccc
tcccagcacccgcacccgacccagccaggcccacatgcgccccatacgttccttcacacg
ctgtacaaaacgtcgcctgatttatcgtcctatgcgcaacatgacgcgcatgagacgttc
atctcgttgttgaatttgatacatagtactacgagggggagtacaaatgttagttgtaat
tgtgttattcatggggtgtttggtgggcagttgcagagcgatgtacgctgtgaacggtgc
gggaatacgacgacggctattgatcccatgttggatgttagtcttgagattgggagggct
ggtgggagtaaaggtggtcccaaggcagcggaggagttgaccttggctgggtgcttgagg
aggttcacgacttcggagaagttgggattgaaagagtatacgtgtacgaagtgtaataaa
gttactacggatgcgagtaagcggatgagtatacggcagttacccgctgtattgagtttt
cagttcaaggtgcgctttatagctggggtcatccctcctccaccatccctcctcttcatc
ttcaaattcttcatctctcgtccaccatctaaccacacctccgctccactcctaaaacag
cgcttcgaacaacgaacaaacgacaaatcctccgctcgtaaactcgacacgccggttcgg
atccctgcgtcgattaatatggcgccgtatacgtctgctgtgttgaaggagatggataag
gagaactcggctgggggtggtgttggtgctggtgtgccgtttatatacccaggaccggag
gccatatatgaatatgatctcttcgctgtgattaaccatgaaggtcagattgataatggg
cattatacgaattatgcgaggtttgaagatgagtggtatcgcttcgacgatgacaaggta
acacactcgagcctcggccaatgtctctcctcgaatccgtacatgtgtttttacgtgaag
cgacacctggattataagccgtacatgacgccgagctatactgtgcttatgcagaagcag
gagagggagcgggaggcgagggaggcgagagagagggagatgagtggggggagtgttggt
gctagtgggagtgggcgggagagagataaagacagggatagagatagggatagagatagg
gacagggatagtagggacgaaagggatgcaagggcttcgagggatagagatgcgagagac
ggtagagatcgcgatagggatagggatagggatagtagagatggaagggatggaaaagac
ggaggaaaggggtatagtaaacgcgagatgccgcctgaggaagatgatatcatgaaagag
attgacgatgctctacttgctactgtgtaa

DBGET integrated database retrieval system