KEGG   Coprinopsis cinerea: CC1G_14672Help
Entry
CC1G_14672        CDS       T01275                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cci  Coprinopsis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CC1G_14672
Enzymes [BR:cci01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CC1G_14672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 284 aa AA seqDB search
MTSQIDSASLSDSLNRLITDDQLKSYTPKSPPSRDGYGFRSSGLNSPLPPHPDQNHSSTT
PTSDHLVPDPKGLGGPAKSPFTVFNAIPEEKGAGAPKMARPFRPFLDCLGEDPARGAFLG
TRERYARGCPCYIRLKPHLDPPPPPPSIDVINDAVFAEDHDEMVIVKDIEFSSLCEHHLV
PFTGKVAIGYIPNKLVLGLSKLARIAETFSRRLQVQERLTRQIAIAVQEAIHPRGVAVVM
EATHMCMTMRGVQKPGSSTVTSCMLGCFRNQQKTREEFLTLIKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccaaatcgactctgcttccctgtccgattccctcaaccgtctcataacagac
gaccaactcaaatcatacacaccaaagtcacctccttcccgtgatggctatggctttcgt
tcctcaggcttgaattctcctcttcccccacacccagaccaaaatcattcatctaccaca
cctacttccgaccatctggtcccagatccaaagggcttgggaggcccagcaaagtcaccg
ttcaccgtttttaatgcaattccggaagaaaagggggccggggcccccaagatggcccgg
cccttccgccccttcttggattgcttgggggaagaccccgcccggggggccttcttggga
acccgggagcgttatgctcggggatgtccctgctatatccgtcttaaaccccatcttgac
cccccccccccccccccctctatagatgtcatcaacgatgctgtctttgctgaggatcat
gatgaaatggtcatagtcaaggacatcgagttctccagtctctgcgagcaccatctcgta
ccatttaccggcaaggtcgccatcggttacatcccaaacaaactcgtcctcggcctctcc
aaactcgcccggatcgcagagacattcagtagacgactacaggtgcaggagagattgaca
agacagattgcaatcgcagttcaagaagcgattcatcctcgaggtgtggctgtggttatg
gaggcgacacacatgtgtatgacgatgcgtggagtccagaaacccggatcgtcgacagtg
acctcctgcatgctgggatgcttccgcaaccagcaaaagactcgcgaagagttccttact
ctcatcaaaaagtaa

DBGET integrated database retrieval system