KEGG   Coprinopsis cinerea: CC1G_14672Help
Entry
CC1G_14672        CDS       T01275                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cci  Coprinopsis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cci00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 284 aa AA seqDB search
MTSQIDSASLSDSLNRLITDDQLKSYTPKSPPSRDGYGFRSSGLNSPLPPHPDQNHSSTT
PTSDHLVPDPKGLGGPAKSPFTVFNAIPEEKGAGAPKMARPFRPFLDCLGEDPARGAFLG
TRERYARGCPCYIRLKPHLDPPPPPPSIDVINDAVFAEDHDEMVIVKDIEFSSLCEHHLV
PFTGKVAIGYIPNKLVLGLSKLARIAETFSRRLQVQERLTRQIAIAVQEAIHPRGVAVVM
EATHMCMTMRGVQKPGSSTVTSCMLGCFRNQQKTREEFLTLIKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccaaatcgactctgcttccctgtccgattccctcaaccgtctcataacagac
gaccaactcaaatcatacacaccaaagtcacctccttcccgtgatggctatggctttcgt
tcctcaggcttgaattctcctcttcccccacacccagaccaaaatcattcatctaccaca
cctacttccgaccatctggtcccagatccaaagggcttgggaggcccagcaaagtcaccg
ttcaccgtttttaatgcaattccggaagaaaagggggccggggcccccaagatggcccgg
cccttccgccccttcttggattgcttgggggaagaccccgcccggggggccttcttggga
acccgggagcgttatgctcggggatgtccctgctatatccgtcttaaaccccatcttgac
cccccccccccccccccctctatagatgtcatcaacgatgctgtctttgctgaggatcat
gatgaaatggtcatagtcaaggacatcgagttctccagtctctgcgagcaccatctcgta
ccatttaccggcaaggtcgccatcggttacatcccaaacaaactcgtcctcggcctctcc
aaactcgcccggatcgcagagacattcagtagacgactacaggtgcaggagagattgaca
agacagattgcaatcgcagttcaagaagcgattcatcctcgaggtgtggctgtggttatg
gaggcgacacacatgtgtatgacgatgcgtggagtccagaaacccggatcgtcgacagtg
acctcctgcatgctgggatgcttccgcaaccagcaaaagactcgcgaagagttccttact
ctcatcaaaaagtaa

DBGET integrated database retrieval system