KEGG   Coprinopsis cinerea: CC1G_14792Help
Entry
CC1G_14792        CDS       T01275                                 

Definition
disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cci  Coprinopsis cinerea
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cci00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CC1G_14792
Enzymes [BR:cci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CC1G_14792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 260 aa AA seqDB search
MLLTNALIALALTPSLVSAALFPRDSKVKSLDEKGFRKAMEKPETSVVAFVAPWCGHCQR
LVPELSKAASSLAPLVPTYAVDCDDDKNKRLCAEQGVKGFPTIKIFPRGKHLNPIPYESE
RSASAIFKAASLRIANPPKKLYKAAEIQPWVEKSTKKPRALLLTKDSKVPLLWKVLSNKY
SGKLDLGTHRDEKGEAASALGVSEGGKGSKVLIYAAGSTDPVLYEGATKMEALSKFFDSV
LDGSADLSNVIKKERASDEL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcacgaatgctttgatcgcgttggcgttgactccttcgctggtgtcggcggcg
cttttcccgagagatagtaaagtgaagtcgttggatgagaaggggttcaggaaggctatg
gagaagccggaaactagcgtggttgcgtttgttgcaccttggtgtgggcactgtcaacga
ttggttcctgaactgagcaaagcggcgagctcgctggccccgttggtgcccacgtatgcg
gtggattgcgatgatgataagaataagcggttatgtgcggagcagggcgtgaaaggtttc
ccaacaatcaagatcttcccccggggtaaacacctgaaccccattccatacgagagcgaa
cggtcagcgagtgccatctttaaagctgcaagcctccgaatcgccaacccaccaaagaag
ctatacaaggctgcagagattcaaccatgggtggagaagagcacgaagaagccgagggca
ctgctgttgacgaaagactccaaggtccctctactctggaaggtcctcagcaacaaatac
agcgggaagctcgatctcggaacacatcgtgatgagaagggcgaggctgcgtctgccctc
ggtgtcagcgaaggtggaaagggatccaaggtcctcatctacgcagcgggctctacggat
cccgttctctacgaaggtgctacgaagatggaagctttgagcaagttcttcgactctgtg
ttggacggctctgcggacctttcaaacgttattaagaaggaacgggcgagtgatgaacta
tag

DBGET integrated database retrieval system