KEGG   Coprinopsis cinerea: CC1G_14792Help
Entry
CC1G_14792        CDS       T01275                                 

Definition
disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cci  Coprinopsis cinerea
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cci04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 260 aa AA seqDB search
MLLTNALIALALTPSLVSAALFPRDSKVKSLDEKGFRKAMEKPETSVVAFVAPWCGHCQR
LVPELSKAASSLAPLVPTYAVDCDDDKNKRLCAEQGVKGFPTIKIFPRGKHLNPIPYESE
RSASAIFKAASLRIANPPKKLYKAAEIQPWVEKSTKKPRALLLTKDSKVPLLWKVLSNKY
SGKLDLGTHRDEKGEAASALGVSEGGKGSKVLIYAAGSTDPVLYEGATKMEALSKFFDSV
LDGSADLSNVIKKERASDEL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcacgaatgctttgatcgcgttggcgttgactccttcgctggtgtcggcggcg
cttttcccgagagatagtaaagtgaagtcgttggatgagaaggggttcaggaaggctatg
gagaagccggaaactagcgtggttgcgtttgttgcaccttggtgtgggcactgtcaacga
ttggttcctgaactgagcaaagcggcgagctcgctggccccgttggtgcccacgtatgcg
gtggattgcgatgatgataagaataagcggttatgtgcggagcagggcgtgaaaggtttc
ccaacaatcaagatcttcccccggggtaaacacctgaaccccattccatacgagagcgaa
cggtcagcgagtgccatctttaaagctgcaagcctccgaatcgccaacccaccaaagaag
ctatacaaggctgcagagattcaaccatgggtggagaagagcacgaagaagccgagggca
ctgctgttgacgaaagactccaaggtccctctactctggaaggtcctcagcaacaaatac
agcgggaagctcgatctcggaacacatcgtgatgagaagggcgaggctgcgtctgccctc
ggtgtcagcgaaggtggaaagggatccaaggtcctcatctacgcagcgggctctacggat
cccgttctctacgaaggtgctacgaagatggaagctttgagcaagttcttcgactctgtg
ttggacggctctgcggacctttcaaacgttattaagaaggaacgggcgagtgatgaacta
tag

DBGET integrated database retrieval system