KEGG   Coprinopsis cinerea: CC1G_14810Help
Entry
CC1G_14810        CDS       T01275                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
cci  Coprinopsis cinerea
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CC1G_14810
   00240 Pyrimidine metabolism
    CC1G_14810
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CC1G_14810
   03410 Base excision repair
    CC1G_14810
   03420 Nucleotide excision repair
    CC1G_14810
   03430 Mismatch repair
    CC1G_14810
   03440 Homologous recombination
    CC1G_14810
DNA repair and recombination proteins [BR:cci03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CC1G_14810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 241 aa AA seqDB search
MPPKGSSLTQTTLSFGSSKPSAVAAKTKKAAGTTRSAGKKANTVTTIDISSSEDEEEQRN
LDDIQEPQPPSDSETEDGIEQHSDEKRPDGSRVLQPTSTKAEKSTTAVSKAKPKTATHET
VKAAESAVKSKVSAEKAEVESRPHLNVKDPAYSRLFAEARQKNGYLPTVHPKEGENRIHE
ILRVFDLSYEYGPTAGMTRLERWQRAKALKLNPPQEIYDILTTQEGIIRPDYRDNVLAGE
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgccacccaaaggatcaagtctaactcagacaacgctgtcttttggcagctcgaagcct
tccgctgttgctgccaaaaccaagaaagcagcagggactacccgtagtgcggggaagaaa
gccaatacggtcactacaatcgacatctcgagcagcgaagacgaagaggagcagaggaac
ttggacgacattcaggaaccgcaaccacctagcgactcggaaacggaggatggtattgag
caacactcagacgagaagcgacccgatggttctcgtgttctgcagccgaccagtaccaaa
gcggaaaagtcaacgacagcggtatcgaaagcgaagccaaaaacagcgacccacgaaact
gtgaaggccgcagagagcgctgtgaagtccaaagtgtccgcggagaaagcagaggtggag
tcacggccacacctcaatgtcaaggaccctgcatatagcaggctctttgcggaagctagg
cagaagaatgggtacctgccaacagtccatcccaaggagggagagaatcgcatacacgag
atattgagggtgttcgacctttcctacgaatatggaccgacggctggtatgactcggctg
gagaggtggcagcgagcgaaggccttgaagttgaacccaccgcaagagatttacgacatc
ttgactactcaagagggaattataagacctgactatcgtgacaacgtcctcgcgggagag
gtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system