KEGG   Coprinopsis cinerea: CC1G_14835Help
Entry
CC1G_14835        CDS       T01275                                 

Definition
acetyl CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cci  Coprinopsis cinerea
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cci01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cci00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cci00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:cci00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 2231 aa AA seqDB search
MSPYDHSKVQHFIGGNSLDKAPASNVRDFVKQQGGHTVITKVLIANNGIAAVKEIRSVRQ
WSYDTFGHERAIEFTVMATPEDLKVNAEYIRMADRYVEVPGGSNNNNYANVDLIVDIAER
AGVHAVWAGWGHASENPRLPESLAASKNKIVFIGPPGSAMRSLGDKISSTIVAQSADVPT
MAWSGTGITETVLSDNGFVIVPDKAYQDACVTTVEEGLKRSEQIGYPVMIKASEGGGGKG
IRKVDSPEAFKNAFHAVAGEIPGSPIFIMKLAGQARHLEVQLLADQYGNAISLFGRDCSV
QRRHQKIIEEAPVTIAKPETFEQMERAAVRLSKLVGYVSAGTVEYLYSHAEDVFYFLELN
PRLQVEHPTTEIVTGVNLPAAQLQIAMGIPLHRIRDIRQLYGVAPNGTSEIDFDMTNPDS
AQLQRKPRPKGHVVAVRITAENPDAGFKPSSGSLQELNFRSSTNVWGYFSVNSAGGLHEF
ADSQFGHIFAYGEDRSESRKNMIVALKELSIRGDFRTTVEYLIKLLELEAFKENTITTGW
LDSLISNKLTAERPDATLAVICGAVTKAHLASDACWTEYKRILDKGQVPGRDVLKTVFGI
DFIYENVRYSFTAARSSQTLWTLYLNGGRTMVGARPLADGGLLVLLDGKSHSVYWREEVG
ALRLMVDAKTCLIEQENDPTQLRSPSPGKLVRYLVESGDHVNAGDQYAEIEVMKMYMPLV
ASEDGVVQLIKQPGVSLEPGDILGILTLDDPQRVKHAKPFEGLLPEMGPPSVAGSKPHQR
LSQSLSVLHDILDGFDNQSIMASTFKELIAVLHDPELPYAEVNAILSSLSGRIPSKLEDS
IRTAMDVAKGKGDGHEFPALRIKKVIDNYIQDGILPQDRTMFRSKIEGLYTVLEKYLHGL
KGHETEVIASLLGRYEATEKLFGGSIEARVLALRDQHKDDLDKVANAVLSHIKVQSKAKL
VFAILEYIKTSNLNVSNPESPLYKVLQGLAALEAKSSTQVSLKAREVLILGQMPSYEERL
GQMETVLKNSVSSNYYGEPDSSTRTPSAEILKELSDSRYTVFDVLPAFFGHQDPMVRLAA
LEVYIRRAYKAYSLLSLDYEEGDTLDDGEVPTVVTWRFNLGQSHSPPSTPRIAIGENRRS
ASVSDLTYMINRHQSQPTRTGVIASFPNVAAMDKGFGKVVSLLPTFDHAEFTERYGSNNE
PPNVVNIALRIFRDEDDKPEDQWNPEIVAFVNKNKDLLVQRGVRRISIMLCRPGQYPVYF
TLRDFKGTWGEEQAIRNIEPALAFQLELSRLSNYNITPRFVEAKQIHIYHAVARENQLDN
RFFIRALIRPGRLRGSMSMKEYLISETDRLVTSILDALEIVSAQHRNADCNHIFMNFVYN
LAVEYEDVVAAMAGFIERHGKRLWRLHVTSSEIRIVLEDTEGNITPIRCTIENVSGFIVN
YHAYQEIVTDKGTTILKSIGDKGPLHLQPVHQAYPTKESLQPKRYQAHLIGTTYVYDFPD
LFSKALQNVWLKARTYDTSLTLPKLLLESKELVLDEHDQITEVDRAPGNNTFGMVAWVFK
MRTPEFPEGRKVVVIANDITYKIGSFGPTEDQFFYLVTQYARQQGLPRIYLSANSGARIG
VAEEVIPLFSAAWTDPAHPEKGFSYLYLTPENYLKLKEKSPSSVKVEEIEDQGERRFKIT
DIIGAQDGLGVESLRGSGLIAGETSRAYDDIFTITLVTARSVGIGAYLVRLGERAVQVEG
QPIILTGAPALNKVLGREVYTSNLQLGGTQIMFKNGVSHLTASSDLQGATHILEWLSYVP
EYRSGPLPVREASDSWDRDIDYTPPKGVYDPRWFIEGKVDEQTSEWLSGFFDKGSFQETL
SGWAQTVVVGRARLGGIPMGVIAVETRTIERVVPADPANPASFEQRIMEAGQVWYPNSAY
KTAQAIFDFNREGLPLIIFANWRGFSGGQQDMYDEVLKQGSKIVDGLSAYKQPVFVYIVP
NGELRGGAWVVLDPSINSEQMEMYADVEARAGVLEPEGIVEIKMRREKITGLMERMDSEY
AALKKASKDTSKSEDERAAALKALNDRETLLQPVYKQIALLYADLHDRTGRMEAKGCAKP
AVWKNARRYFYWALRAKLARSAALAELAQASPGTTYEYRARLLSNVAGIDSSSDPRQATE
VLENLDLSRTVAELRSDYLVRQMLDLSKEDRKAAIDGFTRLADTLSEEERASLISVLQNG
PRSAPPSYNTS
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccctacgaccactcaaaagtacagcactttataggaggaaactcgctggacaag
gcaccagcgagcaatgtgagggattttgtaaagcaacaaggagggcatacggtcattacc
aaggtcttgatcgcgaacaacggtattgccgctgtgaaggaaattcgatctgttcgacaa
tggagttacgacacttttggccacgagcgggccatcgaattcactgtaatggccacccca
gaagatcttaaagtcaacgcggagtacatccgcatggctgatcgatatgtcgaggtccct
ggcggttccaacaataacaactacgccaacgtcgacctcattgtcgacatcgctgaacga
gctggcgtccacgctgtctgggcaggatggggccacgcttcggagaacccaaggctccca
gagagcttggcggcaagcaagaacaagatcgtttttatcggtccccctggctctgcaatg
cgcagccttggagacaagatctccagcaccattgtcgcccagagtgctgacgttccaacg
atggcctggtctggtacaggcattacagagactgtgctctcagacaacggattcgtcatc
gttcccgataaagcttatcaagatgcatgtgtcacaacagtagaggaaggccttaagcga
tcggagcagattggttatcctgtgatgatcaaggccagtgagggtggaggtggaaaggga
atcaggaaagtcgacagcccggaggcattcaagaatgcattccacgcggtagcaggagag
atcccaggttccccaatctttatcatgaagctagctggccaagctcgtcacttggaagtc
cagcttttggcagaccaatacggcaacgccatttcgcttttcggacgtgactgttcggtc
caaaggcgtcaccagaagattatcgaagaggcaccagtcaccatcgccaagcccgaaacg
ttcgagcagatggagcgtgctgccgttcgcttgtctaagctcgtgggttatgtcagtgcc
ggaaccgtcgaatacctttacagccacgcagaggatgtgttttacttcctcgagctcaat
cctcgtttgcaagtcgagcaccctacgactgagatcgtgacgggtgtcaacctcccagct
gcccaacttcaaattgctatgggtatccctctccatcgcatccgtgatatccgacaactc
tacggcgtcgcgccgaacggaacttcggagattgacttcgacatgacaaaccccgattcc
gcccaattgcagcgtaaaccaaggcccaagggtcacgtcgtcgctgtccggattaccgcc
gagaaccccgacgctgggttcaaaccttcctcaggttcattgcaagagctcaacttccga
tccagtaccaacgtctggggttacttctccgtcaatagcgccggaggactccatgaattt
gccgattcgcagttcggtcacattttcgcttacggtgaggatcgtagcgagagtaggaag
aacatgatcgtcgccctgaaggagctcagcatccgtggcgacttcagaacaactgtcgag
tatctcatcaaactcctagaactcgaagccttcaaggagaacactatcaccaccggatgg
ttggactctctcatcagcaacaaactcacagctgagcgaccggacgccaccctcgccgtg
atctgcggagcagtcaccaaggcccacctcgcttcggacgcatgctggacggagtataag
cgcatcttggacaagggacaggtccctggtcgcgatgttctcaagacagtgttcggcatc
gacttcatctacgagaacgttcgatactccttcactgcagcccgctcttcccaaacgctc
tggacgctatacctcaacggaggccgcaccatggtgggcgcccgacccctcgctgacggt
ggtctgctcgtcttgcttgatggcaagagtcattccgtctactggcgggaagaagtcggc
gccttgcgcttgatggtcgatgctaagacctgcctcatcgaacaggagaacgaccctacc
caactacgcagccctagcccgggtaaactcgtccgctacttggtggaaagcggcgaccac
gtcaatgctggtgaccagtatgccgagatcgaggtcatgaagatgtacatgcccctcgtg
gcatcagaggacggtgtcgtccagctcatcaagcagccaggcgtcagccttgagcccgga
gacatcctcggcatcttgactctcgacgacccccaacgcgtcaagcacgccaagccattc
gaaggactcttgccggaaatgggccccccgtctgttgctggcagcaagcctcaccagcgc
ctttcgcagtctctcagcgtccttcacgacatcctcgacggctttgacaaccaatcgatc
atggcgtcgaccttcaaggaactcatcgctgtcctccacgatcctgaactcccttatgcc
gaagtcaatgccatcctttcctctttgtctggccgtatcccatctaaactcgaggacagc
attcgcacagccatggatgtggctaaggggaagggtgatggacatgaattccctgcactc
cgtatcaagaaggtcatcgataactacatccaggatggcatccttccccaggatcgcaca
atgttccgtagcaagatcgagggtctttacacagtcctcgagaagtacctccacggtttg
aagggtcatgagacggaggtgatcgccagccttttgggacgatacgaagccaccgagaaa
ctgttcggagggagcatcgaagctcgcgtccttgcactccgcgaccagcacaaggatgac
ctcgacaaggtcgccaacgctgtcctcagtcacatcaaggtccaaagcaaggccaagttg
gtctttgcgatcttggaatacatcaagaccagcaacttgaatgtgtcgaaccccgagtcg
ccactctacaaggtcctccagggcctcgcggctcttgaagccaagtcctctacccaagtc
tccctaaaggcccgagaggttcttatcttgggccagatgccttcatatgaggagcgactg
ggccagatggagaccgtcttgaagaactccgtctccagcaactactacggcgaaccagat
tcttcaactcgtacaccatccgctgagatcctcaaagaactcagtgattcacgatatact
gtcttcgacgtgcttccagccttcttcggccaccaagatcccatggttagattggccgcc
ttggaagtttatattcgacgcgcctacaaggcttactcgctcctgtccctagattacgag
gaaggtgataccctcgacgatggggaagtcccaacggttgtcacatggcgatttaatctt
ggacaatcccactcaccgccatccactcctcgtattgctatcggagagaacaggcgttca
gcttcagtcagcgatttgacctacatgatcaaccgccatcaatcccagcccactcgaact
ggtgttatcgcctcgttccccaacgtcgcagccatggacaagggtttcggaaaggtcgtc
tcactcttgcctacgttcgaccatgccgaattcaccgaacgttacggaagcaacaatgaa
cccccgaacgttgtcaacattgcattgaggattttccgcgatgaagatgacaagcctgaa
gaccaatggaacccagagatcgtcgccttcgtgaacaagaacaaggacctcctggtgcag
cgtggtgtccgccgtatctccatcatgctctgtcgccctggccaatacccggtctacttt
accttgcgcgatttcaagggtacttggggcgaagaacaggctatccgaaacatcgaaccg
gcacttgccttccagctcgagttgagccgcctttccaactacaatatcactcctcgtttt
gtggaggcaaagcaaatccacatctaccatgccgttgctcgcgaaaatcaactcgacaac
cgcttcttcattcgagccttgatcagacctggacgtctccgcggctcgatgagcatgaag
gagtacctcatctccgagacggatcgcctggtcaccagcatcctcgacgccctcgaaatc
gtcagcgcacagcacaggaatgccgactgcaatcacatcttcatgaacttcgtctacaac
ctcgctgttgagtacgaagatgttgttgccgctatggctggcttcatcgagcgacatggc
aaacgactctggcgcttgcacgtcaccagctcggaaatccgaattgtgttggaagacact
gaaggaaatatcacccccatccgatgcacgattgagaacgtctccggctttatcgtcaac
taccatgcttaccaagagattgtcaccgacaagggtacgactatcctcaagtcgattggg
gacaagggccctctccatctccaacctgtacaccaggcgtatcctaccaaggagtcccta
cagcccaaacgataccaggcccacctcatcggcactacctacgtttatgacttccccgat
ctcttctccaaggccctccaaaacgtttggctcaaggcccgaacctacgacacctcactc
actttgcccaaattgctgctcgaatcgaaggagctggtattggacgagcacgaccaaatt
actgaggtggatcgtgcgccgggcaacaacaccttcggtatggtggcctgggtgttcaag
atgcgaactcccgagttccctgaagggcgcaaggttgtcgtgatcgccaatgacatcacc
tacaagatcggttccttcggcccaaccgaggaccagttcttctaccttgttacccaatac
gctcgccagcaaggcttaccccgtatctatctttccgccaactcgggtgcccgcatcggc
gtcgcagaagaagttatccccctgttctctgcggcttggaccgaccccgctcatcccgag
aagggtttcagctatctctacctcacgccggagaactatctcaagctcaaggagaagagc
ccatcctctgtcaaggtcgaagaaattgaagaccagggagagcgcagattcaaaatcact
gatatcattggtgcccaggatggcttgggcgtcgagtctcttcgtggctctggcctcatt
gctggagagacctcccgcgcttacgacgatatcttcaccattacactcgtcaccgctcgc
tccgtcggtatcggtgcttaccttgttcgactcggagagcgtgccgtccaggtcgaaggt
caacccatcattctcactggcgctcccgccctcaacaaggtcctcggtcgcgaggtttac
acgtccaaccttcaactcggtggtacccagattatgttcaagaacggtgtctcccatctt
actgccagcagcgatcttcaaggtgctactcatatcctggaatggttgtcgtacgttcct
gaatataggagtggtcctctccctgtccgggaggcgtcagattcgtgggatcgcgatatc
gactacactccgccgaagggtgtctacgatccccgctggttcatcgagggcaaggtggac
gagcagacctcggaatggttgagcggcttcttcgacaagggctctttccaagagacattg
agcggatgggctcagactgtcgtggttggccgcgctcgtctcggtggtattcctatgggt
gtcatcgccgtcgagacgcgaactatcgagcgagttgtccctgccgaccccgccaacccc
gcctcattcgaacaacgcatcatggaggccggtcaagtgtggtaccccaactccgcatac
aagaccgcccaagccatcttcgacttcaaccgcgaaggccttcctctcatcattttcgcc
aactggcgtggtttctccggcggtcaacaggacatgtacgacgaggtcctcaagcaaggg
tccaagatcgtcgatggcttgtctgcttacaaacagcccgtcttcgtctacatcgtcccc
aacggtgaactccgtggtggtgcatgggtcgtgctcgatccatccatcaattctgaacag
atggagatgtacgcagatgtcgaagctcgagcaggtgtgttggagcctgagggtattgtc
gagatcaagatgcgacgggagaagattactgggttgatggagcgcatggactctgagtat
gctgctttgaagaaggccagcaaggatacatccaagtctgaggacgaaagagccgctgcc
ctcaaggctcttaacgaccgagagacccttctgcaacctgtctacaaacagatcgctctt
ctgtatgctgaccttcatgatcgaactggccgtatggaagccaaaggctgcgccaagccc
gctgtctggaagaacgctcgtcgttatttctattgggcactgcgcgccaagctcgcccga
tcggccgctcttgcagaactcgcccaagcaagccctggaactacctatgaatatcgagct
cgactccttagcaacgttgccggtatcgactcctcttccgatcctcgccaggccaccgaa
gtcctcgagaaccttgacctcagccgcactgttgcagagttgcgctctgactatctcgtt
cgccaaatgctcgacttgtccaaggaagatcgcaaggctgccatcgacggtttcactcgc
ctcgcggacacgctgtcggaggaagagagagcttctctcatctctgttcttcagaacggt
ccccgatctgctccaccatcctacaatacttcataa

DBGET integrated database retrieval system