KEGG   Coprinopsis cinerea: CC1G_14953Help
Entry
CC1G_14953        CDS       T01275                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CC1G_14953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 362 aa AA seqDB search
MPRDPTQLMAFKWPMALYNELRKWFPLFNLFSFFCAFIIDAPFGRFAPSASDPSTHSIFP
LFNMQALQVDGIRSWIFMELISPFTFIYAFLISPLTFYTPDMPSLTSPITLACTLFMIHY
ANRALISPLRTPSRSKSHLVVVLLAAGFNLANGYLLGSYFSSPMARIYIGGSYAYMRPSF
WIGMTLWLVGFIGNIAHDEILLDIRRKAKARKEKDGEEREDAKKKGKEPKKPAEKGEYYG
IPQGLLYDYISFPNYFCEWIEWFGFALATSPPPVELSFASPADFIQSLLHNAIIPLCSPK
AWSKMIKGNAYGFAPLLTPPWIFFFGEILVMLPRAYRGHKWYKKRFGESYPKNRKAVIPF
VL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcgacccaacgcagcttatggccttcaaatggcccatggcgctgtacaatgaa
ctgcgcaagtggttccccctcttcaacctcttctcgttcttctgcgctttcatcatcgat
gcgccgtttggacgtttcgcgccctcagcgtctgacccctcgacgcactcgatcttcccg
ctcttcaatatgcaggcgctgcaggtggatgggattcggtcatggatcttcatggagctc
atctcgccgtttacgttcatttacgcattcctcatctcgccgctcactttctacacaccc
gacatgccgtccctgaccagccccatcacattggcctgcacgctgtttatgatccattac
gccaacagggctctgattagcccgctcaggacgccttcgagatccaaatcccacctcgta
gtcgtgctgctcgctgctggcttcaacctcgccaacggctacctcctcggatcgtatttc
tcctctccaatggcgaggatctacatcggaggatcctacgcctacatgcgtccatccttc
tggattggaatgaccctatggctcgtagggttcattggcaatatcgcccacgacgaaatc
ctgctcgacattcgtaggaaggcgaaggcacgcaaggagaaggatggggaggaacgagag
gacgccaagaagaaaggaaaggagcccaagaaaccagcagagaagggtgaatactacggc
atcccccaaggccttctctacgactacatctccttccccaactacttttgcgaatggatc
gagtggttcgggttcgcgctcgcgacttcgcctccgcctgtcgagctttcattcgcttct
cccgccgacttcatccaatccctcctccacaacgcgattatccctctttgctcgcctaaa
gcctggtcaaagatgatcaagggcaacgcctacgggttcgctcccctcctaacaccaccc
tggattttcttctttggagaaatcctcgtcatgctcccgagagcgtatagaggccacaag
tggtacaagaagcgctttggggagagttaccccaagaacaggaaggcggttatccctttc
gttttgtaa

DBGET integrated database retrieval system