KEGG   Coprinopsis cinerea: CC1G_15012Help
Entry
CC1G_15012        CDS       T01275                                 

Definition
cytochrome P450 oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CC1G_15012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 748 aa AA seqDB search
MPEGNLSSLRPGLSVALSATGMASSSSDAVIVGLGVVLAALYLFRDQLFATSKPKVVPVA
TKAANGSGNPRDFIAKMKESKKRLVIFYGSQTGTAEEYAIRLAKEAKSKFGLASLVCDPE
EYDFENLDQLPEDCAAFFVMATYGEGEPTDNAVQLMQNLEDESFEFSNGERNLNGLKYVV
FGLGNKTYEHYNVIGRRVDAALTNMGAVRIGERGEGDDDKSMEEDYLEWKDGMWEAFATA
MGVEEGQGGDTADFVVSELESHPPEKVYLGEYSARALTKTKGIHDAKNPFPAPIAVAREL
FTPHADRNCVHIEFNTEGSGITYQHGDHLGVWPINPDLEVERLLCSLGLHDKRDKVIGIE
SLDPALAKVPFPVPTTYGTVLRHYIDISAVAGRQILGTLSKFAPNPEAEAFLKELNTNKE
KYHTVVADGCLKLGEVLQLAAGNDIRKLPTPDNTTAWPIPFDIVVSAIPRLQPRYYSISS
SPKLNPTSIHATVVVLKHENIPSEIVSKKWVYGVGSNFLLNLKHAANNESVPLVTQDGEE
RVSVPAYLIEGPRGAYKVDTTYKAPIHVRRSTFRLPTNPKSPVIMIGPGTGVAPFRGFVQ
ERVALARRALDKNGPDALADWGRISLYYGCRRSTEDFLYKDEWDKYIEELKGKFVLRTAF
SREKFKPDGSKIYVQDLLWEDRQHIASAILEGKGYVYICGEAKNMSKQVEEVLARILGEA
KGGSAEVEGAAEVKLLKERSRLMLDVWS
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaggtaacctgtcgtcgttgcgcccaggcctttctgtcgccttatctgccacc
ggtatggcttcatcgtcgtcagacgctgttatagtcggcctgggggtcgtactagcagcg
ctctacctgttccgtgaccagcttttcgcaacatcgaagcccaaggtcgttccagtcgcc
acaaaagccgccaatggttcaggaaacccccgcgacttcattgcgaagatgaaggagagt
aaaaagcgcctcgtgatattctatgggtcccaaaccggtactgcggaagagtatgccatt
cgtctcgccaaggaggcgaagtccaagtttggcctcgcctccctcgtctgcgatccagag
gaatacgacttcgagaatctcgaccaactgcccgaagactgcgccgccttcttcgtcatg
gctacatacggtgaaggtgaacctaccgacaacgcagttcaattgatgcagaacctcgag
gacgagtctttcgagttcagcaacggagagcgcaatctcaatggcctcaagtatgtcgtt
ttcggtttgggcaacaagacatacgagcactataatgtgatcggacgccgtgttgacgct
gctctaaccaacatgggcgccgtgcgcatcggggaacgtggcgagggcgacgatgacaag
agcatggaggaggactacctagagtggaaggatggtatgtgggaagccttcgctaccgcc
atgggtgtcgaagagggtcagggtggtgacacagccgactttgtcgtctcggagctcgaa
tcccatcctccggaaaaggtctacctaggcgagtactcggcccgtgccttgacaaagacc
aaaggtatccacgatgccaaaaacccattcccggctcccatcgccgtcgctcgtgaacta
ttcaccccccacgctgatcggaattgcgttcacatcgaattcaacaccgaaggttctggc
attacttaccaacacggtgaccaccttggtgtatggcctatcaatcccgacctcgaagtc
gagcgtcttctctgctcactcggtttgcacgacaagagggataaggtcatcggcattgag
tccctcgatcctgctctagccaaagttcccttccccgtccccacgacttacggtactgtc
ttgcgccactacattgacatcagcgctgtcgctggtcgccaaattctcggcaccctctcc
aagttcgctcccaacccggaggccgaagctttcttgaaggagcttaataccaacaaggag
aagtaccatactgtcgttgccgatggatgcctcaaacttggagaggtccttcagttggct
gcaggcaatgatatccgcaaacttcccaccccggacaataccacagcatggcccattccc
ttcgatatcgtcgtatcggcaatcccacgacttcaaccccgctattattctatctcctct
agtcccaagctcaaccccacttctattcacgcgactgtggtggtcctgaaacacgagaac
atccccagcgagattgtctccaagaaatgggtatatggcgtcggctcaaatttccttctc
aatctcaagcacgcggccaacaacgaatcagttccccttgttactcaagatggcgaagaa
cgtgtttccgtcccagcgtatctcatcgaaggtccccgcggtgcttacaaggtcgacaca
acgtacaaggcaccaatccacgtgcgacgatctacatttagattgcccacgaacccaaag
agtccagtgattatgattggccccggaactggtgtggctcctttccgtggtttcgtccaa
gaacgtgtggctctcgcccgccgtgccctagataagaacggtccggatgcattggcagat
tggggcagaatatcgctgtattatggttgccgccgctccacggaagacttcctgtacaag
gacgagtgggacaagtacattgaagagctcaaaggcaaattcgtcctccgcacggccttc
tcgcgcgagaagttcaaacctgatggcagcaagatctacgtgcaggatctgctatgggaa
gaccggcagcacatcgcctctgccattctcgagggcaagggctacgtgtacatttgcggc
gaggccaaaaacatgagcaagcaagtcgaagaggttcttgctcgcatcttgggtgaagcg
aagggtgggtctgccgaggtcgagggcgcagcagaggttaagctgctcaaggaacgctcg
cggctgatgctggatgtctggagttaa

DBGET integrated database retrieval system