KEGG   Coprinopsis cinerea: CC1G_15133Help
Entry
CC1G_15133        CDS       T01275                                 

Definition
Pcmt1-prov protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cci  Coprinopsis cinerea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 230 aa AA seqDB search
MAWRCSGATNKELIANLKSGGIFHSDRVMKAMAAVDRGNYVRDKSDAYKDSPQPIGHGAT
ISAPHMHAYASEHLLPYLRPGARVLDIGSGSGYLAAVLHHLVSPGGKVVGIEHIPELAEW
SIGNLKRDGLGEALDKGEIVIVAGDGREGWKDGGPYDAIHVGAAAPTVPPALLEQLASPG
RMFIPVGSWDQYIEHIDKDDKGHVTKQKVMGVRYVPLTDRDKQVESSRMR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaggtgcagcggagcaaccaacaaggagctgattgcgaatttgaaaagtgga
gggattttccactctgacagggtgatgaaggcgatggcggctgttgatcgaggcaactac
gttcgcgacaagtcggacgcatacaaagattcgccgcaacctatcggccatggcgcaaca
atcagtgcccctcatatgcacgcctacgcctccgaacatctcctcccatacctccgcccc
ggtgcccgcgttctcgacattggaagcggctcgggctacctggccgcagttcttcaccac
ctcgtctcacccggtggcaaggttgtcggcattgagcacatccctgaactggcggaatgg
agcatcggcaacctgaagagggatggattgggcgaagcattggacaagggggaaattgtg
atcgtggcaggcgatgggagagagggttggaaagacggcggtccctacgacgccatccac
gttggagcagcagcgccgaccgtccctcccgctctcctcgaacagctcgctagtcccggg
aggatgttcatccccgttggatcttgggaccagtacatcgagcatattgacaaggacgac
aaaggtcatgtcaccaagcagaaggttatgggtgttcgctatgtcccgttgactgatagg
gataagcaagtcgaatcatcgcgaatgagataa

DBGET integrated database retrieval system