KEGG   Coprinopsis cinerea: CC1G_15212Help
Entry
CC1G_15212        CDS       T01275                                 

Definition
atypical/PDHK/PDHK protein kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CC1G_15212
Protein kinases [BR:cci01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CC1G_15212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 637 aa AA seqDB search
MSAGFRITPALWDKIHHFASFPQTGVSLQQMVLFGQNPSQGTLLKASQFLSEELPVRLAH
RVKELDELPHNLSDMPSIKRVKNWYAQSFEELINFPHPQLPPEIRQALITSRSDELALPE
SKPNPSLIDTIYGSSPSNGNGNGGNGFNKLRLRVPMERRYYANTSNITHWPPEVQDYNKR
FTKLLEHIKSRHDPTVTTVAQGRSFRLPAFFGVLGVFWASGLGSVPLPSLYSRSMDPFVI
CEEHALTELSIPFTLPQCLHAPLLGFLSLSLTHALASRLPPTFLVTGPRLPRTDLLCVLE
WKRSQNARHIGLDIQAWLDRFYMSRIGIRFLIGQHVALNTQQAHEDYVGIICTKAVRVPP
SPSPFDTLFHFFGTSSAIEPHTDETAFLFLFRMRLVVVVVDVIVMDTLVVVMRSRYLDST
RLGRCDVFGIWFCLDLGGYGAISRTFYTCAVISGLWNVHDIVQEAIENARFVCEEHYAMF
KGPPVQLICPPSLTFAYVPGHLSHICFELLKNSLRAVVERYGVDAEDHFPPIKVIVVEGK
EDITIKISDEGGGIARSAIPLIWTYMYTTMEHQTSLDEDFQASDFKAPMAGFGYGLPLSR
LYARYFGGDLRLIAMDGFGTDVYIHLNRLSSSREPLP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgggattcaggataacaccagccctatgggacaagattcaccattttgcgtcc
tttcctcagacgggagtgtcactgcagcagatggtgttgttcggtcagaatcccagtcaa
gggacgttgttgaaagcgagtcagtttctatcagaggaactgcctgtacgactggcacat
cgagtaaaggaactcgacgagctaccgcacaatttgagcgacatgccgtccatcaagcgc
gtgaagaactggtatgcccagtcgtttgaggaactaataaacttcccgcacccgcaactc
ccgcctgaaatccgccaagcactcatcacctcccgatccgacgaactcgccctcccagaa
tccaaaccaaacccttccttgatagataccatctacggttcctcgccttccaacggtaat
ggaaatgggggtaacggtttcaacaagctgaggctgagagtgcctatggagcggagatac
tacgctaatacctccaatatcacacattggccacccgaagtgcaagactacaacaagcga
tttacaaagttgctggagcatatcaagtctagacatgacccgactgttaccaccgttgct
caggggcgttcgtttcgccttcccgccttcttcggcgttctgggtgtgttctgggcgtct
gggctcggttcagttccccttccttcactctactcccgttccatggatccctttgtgata
tgtgaagaacatgcgctaacggaactatcaattcctttcactctccctcaatgtcttcac
gctcccttacttggcttcctttcgttgtccttgacgcacgctctcgcctctcgcctgcca
ccaactttcttggttactggaccccgcctgccacgaaccgacttgctttgcgtcctcgaa
tggaaacgttcccaaaacgcacgacatatcgggttagatatccaagcgtggttggatcgg
ttttatatgagtcggattgggattcggtttttgattgggcagcatgtggcgctgaacacg
caacaagctcatgaagattatgtggggattatttgtacgaaagctgtacgtgttcctcct
tcgccttcacctttcgacacgctctttcattttttcggcacttcatcggcaattgaaccg
catactgacgaaaccgctttcttatttctttttcgtatgcgactcgttgtggtggtggtg
gatgttatcgtaatggacaccctggttgtcgtgatgcgctctcgttatctcgactcgact
cgactcggtcgttgtgatgtgtttgggatctggttttgccttgatctcggtggttatggt
gccatttctcgaaccttttacacctgcgccgtaatctccggcttgtggaacgtgcacgac
attgtgcaagaagcgattgagaatgctcgatttgtgtgtgaagagcattatgcgatgttc
aaagggccgcctgtgcagttgatttgtccaccttctttgacatttgcttatgttcctggc
catttatcacatatctgcttcgagcttctcaagaactctttacgagctgttgtggaacgg
tatggtgtggatgcggaggaccatttcccgcctatcaaggtcatcgttgtagagggaaag
gaggatatcacgatcaagattagtgatgagggaggtgggattgcgaggagtgcgattccg
ttgatttggacgtatatgtatacgactatggagcaccagacaagtttagacgaagacttc
caagcgagcgatttcaaagctccgatggctgggtttggatatgggttgcctctgagtaga
ttgtacgcaagatatttcggtggcgacctacggttaatcgcgatggatggatttgggacg
gatgtatacatccacctgaataggttgtcgagtagtagagaacctctaccttga

DBGET integrated database retrieval system