KEGG   Coprinopsis cinerea: CC1G_15273Help
Entry
CC1G_15273        CDS       T01275                                 

Definition
ubiquitin carboxyl-terminal hydrolase 6
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cci  Coprinopsis cinerea
Brite
Enzymes [BR:cci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CC1G_15273
Peptidases [BR:cci01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CC1G_15273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 558 aa AA seqDB search
MAPLAVHIKHAGKTHDVQLDPDLPPAAFKEAIYQVTGVPVDRMKVMVKGGVLKGQTFMVI
GAAGELPKPPEKPIVFLEDMDDSELAEALAKPVGLKNLGNTCYMNATVQALRAIPELQTA
LSAPALQSTTPLPGSLRDLYHNMSRTTDSMVPAGFLQTLRQVNPQFAEMDRSEKRSGMPG
MPMGYAQQDAEECYAAIVNSLRNVPGLTEDGVVASTSAQATTGSRRFVEQYLLGVMTREM
TCDEAPEEPKTVQEESVLKVECNISVSTNFMLQGILSSLDQKIEKNSPSLGRQAVYTQKS
RLSRLPTYLTVHMVRFAWRADIGKKAKIMRRVKFPLEFDATDLATDELKAKLLPASRKLK
EIERERAERLKVRKKTKVATGPAQPAAAESSSSGATGGGDVEMSDAAADTSAAGGELQPE
HVYREKEAKELNELIHADLKSDVGSSATGLYDLVAIITHKGAAADAGHYIGFVKKSVFHP
IKGQSAPPPAVPGQAEAAGSSSTTGTPKAIAEIEPDDEDWYKFDDDKVSIFPKEKIPTLE
GGGEDSSAYVLLYKSKGV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctcccctggcagttcacataaagcacgctggaaagactcatgatgtccagctcgac
cccgatctgcctccagcagcattcaaggaggcgatctaccaggttactggcgtcccagtc
gaccgtatgaaggtcatggtcaagggcggtgttctgaagggacaaacctttatggtgatc
ggcgctgctggggagctcccaaagccaccagagaagcctatcgtcttcctcgaagacatg
gacgacagcgagttggcagaggctcttgcaaagccagtcggcttgaaaaatcttggaaat
acttgctatatgaacgctaccgtccaagctctccgtgccatacctgaactgcaaactgcc
ctcagcgcaccagccctgcagtctacgacaccgttaccaggctcattgcgcgatctgtac
cacaacatgtcccgtaccaccgatagcatggtcccagcaggcttcctgcaaacgcttcgc
caggtgaacccacagtttgccgaaatggaccgaagtgagaagcgttccggcatgccaggg
atgcctatggggtacgctcaacaagacgcggaagaatgctacgcagctatcgttaactcg
ctacgtaacgtccctggtctgacggaagatggagtagtcgcaagcacgagtgcacaggcc
acgactggttcccgccggttcgttgagcaatacctgctcggtgtgatgacgagggagatg
acctgcgacgaggcacccgaagaaccgaagaccgtccaggaagaatctgtcctcaaggtc
gaatgtaacatctccgtttccaccaacttcatgttgcaggggatcttgagctctcttgac
caaaagatcgagaagaactcaccgtcattgggccgccaagcagtctacacgcagaaatct
cgcctctcgagattgccaacctacctcactgttcatatggtccgcttcgcatggagagcc
gatattggcaaaaaggcgaagatcatgcgccgtgtaaaattccccctcgaattcgacgcg
accgatctcgcgaccgacgagctcaaagccaagctcctccctgccagccgcaagctcaag
gagatcgagcgcgagcgagctgagcggctcaaggtccggaagaagaccaaggtcgccact
ggccccgctcagcccgctgctgctgagagctcgtcttcaggcgcgacaggaggtggtgac
gtcgagatgtccgatgcggctgccgatacgtctgccgctggtggcgagttgcagcctgag
catgtttatagggagaaggaagccaaggaactcaatgagctcatccatgctgatttgaag
agtgatgttggaagcagtgcgactgggctttacgacctcgttgctatcatcacccataaa
ggcgccgcagcagatgcaggacactacatcggattcgtgaagaagagcgtcttccatcct
atcaaggggcaatctgctccgccgcctgctgtgcctggtcaagccgaggctgctgggtcg
tcgtcgactactggcactccgaaagcgattgcggagattgagcctgatgatgaggattgg
tacaagtttgatgatgataaggtttcgattttccccaaggagaagattccgacgcttgag
ggaggaggagaggattcgtctgcgtatgttttgttgtataaatcaaaaggtgtgtga

DBGET integrated database retrieval system