KEGG   Coprinopsis cinerea: CC1G_15535Help
Entry
CC1G_15535        CDS       T01275                                 

Definition
Setd1a protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
cci  Coprinopsis cinerea
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CC1G_15535
Enzymes [BR:cci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CC1G_15535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1614 aa AA seqDB search
MSGRPPPKGPRALSAAGPSSSSTAPSSSSLSVHGPPPLPSQRPPPSSHYSKPIPTGPRSL
HSTTRFSHSSPKTPYNGFSNNSSFVNSAGPSMPNGLNVRDSQSSRYSSSTNGKKTEIVSE
STTRQPSDSQRLSWSEPTTNGIAPSNSIPETRPSISIPIPSSSSSLAALPAKRASVQIAL
PSSSSRGPPPPPPDEPPPPPPPPSQPPPPAPPPPEPSPSLPKPPPPPPTSIRPPSPKSQP
PPPPPPPPQTRPPSPPKSIPPPPPPPTSNPEPPPPPPPSVPAPPPPESHPQPGPSTRIPP
PSSQPHSPIRSRPIELPLPPKPVLSERPHPRIHSPPRGSSSRNRSPRPRSRSRPPHPSSS
RPRSRSPRSWSRSPSPGPRYHYDRRRSRYSPPPRRDRDRDWERDRDYRRPYRSPPPRRPD
YPPSSRLPPRPLSPRRERERERDREREREPPPQPPTPRTRSPEKEPEPPQKLYSLPPPPE
WPPPGSSEYPKDERTFKVLYDAAVDVNMASHPSFVSNYSKLPSYYRSLIDHLKKHASSEV
QQKRLQTTGKGKGKESVVLYRYEGEVITTKSEEDGFMEEEPVPTDPRKLEGVKAIRQYRG
YREELTQVQYEYDEHSSGPPPPTAVLFTNLSPLTSNSDLKRHLGQYGQIVSFDPQIDREK
GSALGVVHVRFMTHEEARRCLEKENGRKGGLKNMQREEEWNVVFDGEGKVLQSYKILLDQ
ARKDERKPTGPPAVGPGPGQRPRLPNGIPSTSSLPARPTGGSTPQTPIHPYSSHGPPPPK
PPHLPASVPPNPMHAAQQSHSHSHSSTPNDRHSRSYHPDRDRDRGDKRSRDQRLTPLQPP
SGEAPIPHALLRAKEQVLQKPATDEKGSKPDIDNARGMHVDSPSTNAREPAQPGQPSSSS
LSTSATAAPAEKKPVIPEISEEEKARERERVMRELASIGKEYVHVRFPPHVNPNTLKESK
IRPYFDSFGTVPDKILRNFEGAYVTFAKPGSAVRASILLATVPLLAHRVKLSHHLPPPPP
PPPASESTTTPPSTTSTTSPSNYPPWTPDDAKKILDQAHELIVNEVKALLEKELNDKFIF
NDVKQAMIEEKTSLASKNEQQAAASRPKVKMGLKGLSFKKQKKRVVEEKKPVEEEEVVEK
KERKDKKDRKDRSDEKAVSADVEQEQEMEEEEEEVDRRPRKKARKDVKRPSRIVDDDDIE
SEDEPEDSRLRADSAAVEEPRRKRATSEIQEDDDEAEVEQPVKKKVKLEAGTTKGRKSKK
SKKERAVEVLHVDENDDEAQPPAVARIVVRSDLESTTSRSPSPTSRRPTRAVTPPPTPPP
NPIELGLCEDEEDLYFAKLALAGYDPSTAVAQEEAPAAGAESAPEPSEPTSSRKHLTGSA
RTEGFYKITKQDKAMYLEQYKSKAAAEVIPSVPAAEKPPPQQVMSSRSNRANARRRAAGL
EEINQVQRAVALSKGETAASELTFKFNQLQTRKKHLRFSRSPIHDWGLYAMEKISKGEMV
IEYVGEVIRAQVADKREKTYEKQGIGSSYLFRIDEEFVVDATKKGNLGRLINHSCDPNCT
AKIITISGVKKIVIYAKQDIELGEEITYDYHFPIEQDNKIPCLCGSARCRGYLN
NT seq 4845 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggagacctcctccaaagggtcctagggctctgtcggcggctggaccatcgtcc
tcgtcgacggcaccgtcctcgagctcgctgtctgtccatggcccacctcctttgccgtcc
cagcgccctccaccaagctcgcactactcaaaaccgattccaacagggcctcgaagcctt
cactcgacaaccaggttttcccattcgagtcccaaaacaccgtataatgggttcagcaac
aacagcagctttgtaaactccgctggaccaagcatgcccaatggcttgaatgtcagagat
tcacagagcagtcgatattcgtcctcaacaaacggtaaaaagacagaaatcgtgtctgaa
tcgacgacccggcaaccaagcgactcacagcgactgagctggtcagaaccgacaacaaat
ggaattgcgccgtcaaactcgattccagagactcgtccttcgatttcaataccaattccg
agctcgagttcaagtttggcggcgctgcctgcaaaacgagcttcagtacaaatagccttg
ccctcgtcgtcgagccgtggcccaccaccacctccgcccgacgaaccacccccgccgccg
cctcctccgtctcaacctccgcccccagcgccgcctccacccgagccatcgccgtctctg
cccaaaccaccaccgccgccgccgacttcaatacgaccgccctcgccgaaatcccagccc
cctcctccgcccccgccacccccgcaaactcgacctccttccccaccaaaatcgattcca
cctccgccaccacctccaacgtcgaatcccgagcctcctccgcccccgccaccctctgtt
ccagcacctcctccgccagagtcacacccgcagcctgggccatctacacgaatacctccg
ccatcgtcacaaccccattcgccaatacgaagtcgtcccattgagctgccgcttcccccc
aaaccggtgctctcagaacgcccccatcctcggattcactcgccccctcgcggctcgtcg
tcacgaaaccgctctccgaggcctcgctcgcgatcacgaccgccccacccatcttcttca
cgacctcggtcccgttctccccgttcgtggtcgaggtcgccgtctcctggaccacggtac
cactatgatcgtcggcggtcacgatactcaccaccaccccgtcgggatcgagaccgtgat
tgggaacgggatcgggactaccgacgtccttaccggtctccaccacctcgaaggccagat
tatccgccttcaagtcgtctacctcctcgaccactgtcaccacgacgggaacgtgaacgg
gagcgagaccgggagcgggaacgggaaccaccgccccaaccacccacgccgcgcacacga
tcgccggagaaggagcctgagccgcctcaaaaactctattccctaccacctccaccagaa
tggccacctccagggtcgagcgaataccccaaggacgagcggacgttcaaagttctctac
gacgcagctgtggatgttaatatggctagccatccatcttttgtctccaactactcgaaa
ctcccatcctattaccgcagtctaatcgaccacctgaagaaacacgcgtcatccgaggtc
cagcagaagcggttacagacgacggggaaaggaaaagggaaggagagtgtggtgttgtat
aggtatgaaggagaggtgatcacgacgaaatcggaagaggatgggtttatggaggaggag
cctgtgccgaccgatcccaggaagctggagggtgtgaaggccattcgacagtatcgaggg
tatagggaagagctaacgcaggtgcagtacgagtatgacgaacactccagtggccctcca
ccgcccaccgcggtccttttcaccaacctctcccctctgacctcaaacagcgacctgaaa
cggcaccttggacaatatggccagatagtctcattcgacccacagatcgaccgggaaaaa
ggaagcgcactcggagtcgtacatgtcaggttcatgacgcacgaagaggctaggcggtgt
ctggagaaggagaatggacggaagggagggttaaagaatatgcaaagggaggaagagtgg
aacgtggtgtttgacggtgaagggaaggtacttcagtcgtacaaaatcctgttggatcag
gcgaggaaagacgagcgaaagccaactggaccaccagcagtagggccaggaccaggacaa
agaccgaggcttccgaatggaataccgagcacaagttccctgcctgcgaggcctaccggt
ggcagtacgccgcaaacacccatccatccctactctagccatgggccaccaccaccgaag
ccaccccacctacccgcgagcgtgcccccgaaccccatgcatgcagctcagcagtctcac
tcgcattcccattcgagcacacccaatgatcgacattccagatcctaccatcccgaccgt
gaccgcgaccgtggggacaaacgtagccgtgatcagcgtctgactcctctgcagccacct
tcaggcgaagctcctatccctcacgcgctgctcagggcgaaggaacaagttctgcagaaa
cctgccacagatgagaaagggtcgaaaccggatattgacaatgcccgtggcatgcacgtc
gactcaccttcaacgaatgcccgtgaaccggctcaaccaggccaaccgtcttcatcgtcc
ctttcgacgtctgccaccgctgctccagccgagaagaagcccgtcattccagagatctcg
gaagaggagaaggccagggagagggagagagtgatgagagagttggcgagcattgggaag
gagtatgtccacgttcggttccctccccatgtgaatcccaatactctgaaggagagcaag
attcggccatattttgacagcttcggtacggtcccggacaagatccttcgcaactttgaa
ggggcatatgttacctttgctaaacccggatcagccgttcgagcttcgatcttgctagcc
acggtgcctcttctggcacatcgcgtgaaactcagccatcacctgcctcctcctcctccc
cctcctccagcatctgaatccacaacaacgccaccctctacaacatcaaccacgtcccca
tctaattatccaccatggactcccgacgatgccaagaagatcctggaccaagctcacgaa
ctaattgtgaacgaggtcaaggccttgctagaaaaggagctgaacgacaagtttatcttc
aacgacgtcaagcaggccatgattgaagaaaagacatctctagcgagcaaaaacgagcag
caagcggcggcctcgaggcccaaggtcaagatgggcttgaaggggctgtcgttcaagaag
cagaagaagcgggtggtggaggagaagaaaccggtggaggaggaagaggtcgtggagaag
aaggagaggaaggacaagaaggataggaaggataggagtgatgagaaggccgtttctgcg
gatgtggagcaggaacaggagatggaagaagaggaagaggaagttgaccgtcgaccaagg
aagaaggcccggaaggatgtcaagagaccctcgaggatcgtcgatgatgacgatatcgaa
tcagaggatgaacctgaggactctcgacttcgcgccgactctgcagctgtcgaagaacct
cgacgtaaacgtgctacctccgagatccaagaggacgatgacgaagctgaggtggaacag
cctgtcaagaagaaggttaaacttgaggccgggacgacgaaagggaggaaatcgaagaaa
tcgaagaaggaacgtgcagttgaggttctacatgttgacgagaacgacgacgaggctcag
cctccagccgtggccaggattgtcgtcagatcggaccttgaatccaccacgtctcgcagc
ccatcccctacctcgcggcgtcctacacgtgcagtcactccccctccgacgccacctccc
aaccctatcgaactcggactatgcgaagacgaagaagatttgtactttgccaaacttgct
ttggcgggatatgatccttctacggcagtggcacaggaagaggcaccggcagcaggagcg
gaatcagcaccggaaccctcggagccgacgtcctcgaggaagcatcttaccggatcggct
cgaacggaagggttctacaagatcacgaaacaagacaaggccatgtatctcgagcagtac
aagtccaaggctgcagcagaggtcataccctccgtcccagcggctgagaagccacctcct
cagcaagtcatgtcgtcccgttcgaaccgtgctaatgcccgtcgtcgcgcggctggtctg
gaagagatcaaccaagtccagagagcggtggcgttgtccaagggcgaaactgctgctagt
gagcttacgttcaagtttaaccaactccagacgaggaagaagcatttgcggttctcgagg
tcgcctattcacgattggggtctttatgccatggagaagatttcaaagggtgagatggtg
atcgagtatgtgggagaggttattcgtgcgcaggtcgcagataagcgggagaagacgtat
gagaagcaggggattggaagtagttatttgtttaggattgatgaggagtttgtggtggat
gccacgaagaagggcaatcttggacgattgatcaaccattcttgcgaccctaattgtacg
gccaagattattacgattagcggggtgaagaagattgtcatctatgcgaaacaagatatt
gaacttggcgaagagattacctatgattaccacttccccatcgaacaagacaacaagatt
ccatgtctatgcgggtcggccaggtgtcgcgggtatctgaactag

DBGET integrated database retrieval system