KEGG   Coprinopsis cinerea: CC1G_15556Help
Entry
CC1G_15556        CDS       T01275                                 

Definition
folic acid synthesis protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
cci  Coprinopsis cinerea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cci00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 743 aa AA seqDB search
MVSTVEFFVEDLVCPTIIGVGPQERLEKQDVVVNFKIQNAVEAMVIDPPDLRDLVKQVFE
MVQDSTYLTLEALSSAIAKDILMILAYGKTPVKVTVSASKPHALPLAKSSEVVITRTLED
YEHLHHVDHRTVPRTMTVAPSTVHKVVLALGSNLGDRFKNIESALRLLEIPGEVLKEHKP
VDGDKAEAMKVDVVDTSFLYETAPMYFTDQPAFINGACVIETNLSPLTLLLLVKTIETIV
GRVPSVRNGPRAVDLDIILYDNDVFDTRPVEDRKDLDNLEGQLVIPHPRLAEREFVLRPL
NDIVPDLVHPVLKKSIARLLQDLHISPSDPPMEKVIPFPRLPPRQDTAFAYPIEQVPDTL
THWKYGKAGTKVMATLNTTPDSFSDGSTHNVLPAAISYVKDSVTAGARIIDIGGYSTRPG
AAFVSVDEETNRVVPYVQAIREQNGQDQVADIPISVDTFRWEVAEAALAAGANCINDVYS
FTGPDSYPHSEKNNQEAEGIMTKMKAIARRGDAGQNKDYKVYEYAGPNEAVLEGVRVELG
EKVEKIVKGKGGVRRWSVIVDPGIGFSKTLDGNLEVLRHASQVVDAPFIGPEGNKMNPLY
GFPQLIGVSRKSFLGAILAEGQHGRKTTPKERVFATAAAVSCAVQQVRFSLHKMVCPPQE
LQSAHTLCGARDPPPEYVEAISARLRYNSRNCCNGQYNTAATCPASENACPHSYAYAYDE
GSSTALFTCPGIRRADYTVTFCP
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgacggtggagtttttcgtggaggacttggtttgcccaacgatcatcggcgta
ggcccccaagagcgactagaaaaacaggacgttgtcgtcaacttcaaaattcaaaatgcg
gtggaggctatggtcatcgatccaccggacctacgcgatctagtcaagcaggtcttcgag
atggtacaggactctacctacctcacgctggaagccctatcctctgcaatcgccaaagac
attttgatgatcctcgcgtacgggaagacgccagtgaaggtcaccgtcagcgcttccaaa
ccccacgctctacccctcgccaaaagctcagaagtcgtcatcacgcgcaccctagaagac
tacgaacatcttcatcatgtcgaccaccgcaccgttcctcggactatgacggtggctccg
agtaccgttcacaaagttgttttggctctgggatccaacctcggtgatcgattcaagaat
atcgagtcggcactccgtcttttggaaatcccgggagaagtgctcaaagaacataaaccg
gttgatggtgataaggcagaggcaatgaaggtggacgtcgtggacacgtctttcttgtat
gaaactgcccccatgtacttcaccgaccagccggcttttatcaacggtgcttgtgtgata
gaaaccaatctatcaccgttgacgctacttctcttggtcaagactattgaaactatcgta
ggacgcgtcccgagtgtcaggaacggccctcgagcggtggatctggatatcattctatac
gacaacgatgttttcgatacccgacctgtggaagaccgcaaggacctggacaacctggag
gggcaactcgtgataccccaccctaggttggctgaacgagaattcgtccttcgtcccctc
aatgacatcgtccctgacttggttcaccctgtgttgaagaagagtatcgcaaggctcctc
caagacctccatatatctcctagcgacccgcctatggagaaagtaatacctttccctcgc
ttaccaccgcgtcaagataccgccttcgcctaccctatcgaacaagttccagataccctc
acccattggaaatacggcaaagctggaacaaaggtcatggcgacgctcaatacaactccc
gactccttctcagacggttcaacccacaatgtccttcctgccgctatatcctatgtcaag
gactctgttactgccggtgcgcgtatcatcgacattggggggtactcgacgcgtcctggt
gccgcgtttgtctcggttgacgaggagaccaatcgggtcgttccgtacgtgcaagcaatc
cgagagcaaaacgggcaagatcaagtggcggacattcctatcagcgtggacactttccgt
tgggaagtggcagaagcggctttagcagctggtgccaactgcatcaacgacgtttattcg
ttcaccggacccgactcgtacccccattccgagaaaaataaccaggaagcggaagggatc
atgacgaagatgaaagcgatagcacgtcgaggggacgcgggtcagaacaaggattacaag
gtatacgagtatgctggaccgaacgaggcggttttggagggtgtcagagtcgagttgggc
gagaaggtggagaagattgtgaaaggcaagggtggggtgcgtagatggtctgttattgtg
gatcctgggattgggtttagcaagactttggatgggaaccttgaggtgctgaggcacgcc
tcgcaagtcgttgatgcgccgtttattggacctgagggcaacaaaatgaatcccctttat
ggattccctcaacttattggtgtctcgcgcaagtcgttcttgggtgccatccttgctgaa
ggacaacatggacgcaaaacgacaccaaaggagcgcgtgtttgcgactgctgctgctgtc
tcgtgtgcggttcagcaggtgcgcttttcccttcataaaatggtgtgtccaccgcaagaa
ctgcagagtgctcatacgctttgtggagcacgagatccgccgccggaatatgtggaagcc
attagcgcgagactacggtacaactctaggaactgttgcaatggccagtacaatactgct
gcgacgtgtcctgcttccgagaatgcctgtcctcactcctacgcttatgcctacgacgaa
ggaagcagtaccgccctcttcacgtgccccggcatcaggagggctgactataccgtcact
ttctgcccttaa

DBGET integrated database retrieval system