KEGG   Coprinopsis cinerea: CC1G_15725Help
Entry
CC1G_15725        CDS       T01275                                 

Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
cci  Coprinopsis cinerea
Pathway
cci00260  Glycine, serine and threonine metabolism
cci00330  Arginine and proline metabolism
cci00472  D-Arginine and D-ornithine metabolism
cci01100  Metabolic pathways
cci01130  Biosynthesis of antibiotics
cci04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cci00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC1G_15725
   00330 Arginine and proline metabolism
    CC1G_15725
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CC1G_15725
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CC1G_15725
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CC1G_15725
Enzymes [BR:cci01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CC1G_15725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 9378621
NCBI-ProteinID: XP_002910296
UniProt: D6RQI6
Position
11
AA seq 398 aa AA seqDB search
MTKGGHWTPHLPTSRSGTHTPDTPGKPILVLGAGVIGLTTALKIQLQGGYRVLILADTLP
SDPKSIAYTSQWAGAHHVYSAREENGLQYKLEQATFDTMWKKSEPGSEAEECFLRVPQTE
YFFDEASEIKPLRSMPNFKYLEQDSLIPGAKLGVSFTTLTIDTPIYLNYLLSRFLANGGK
ILRGSVQHINQVIEAGARIFAGGTTVGHSADPPVAVINCTGLGARFLGGVEDKSVYPVRG
QTVLVRAPWVRFGRTTYRDDTGAWTYIIPRRSSDVIVGGTRARDDWFPKPRPETTEDILR
RGLELCPELAPPEARLGGRKPTLEDVMPHVVGEGCGLRPAREGGVRIETEWTEDIGGRGR
VPIIHNYGHGGAGFQASWGSSVVVLELLEEALSQLEKS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagggaggccattggacgcctcacttgcccacaagtcgaagtggaacccatacg
cccgatactccagggaagcctatcctggtcttaggggctggtgtgattgggttgacgact
gcgttgaagatccagctgcaaggcggatacagagtgcttatcttggccgatacccttcca
agtgatcccaagtcaatcgcgtacacgagtcaatgggcgggcgcgcatcatgtatacagt
gcaagggaagaaaatgggctgcagtacaagctcgaacaagcgaccttcgatacgatgtgg
aagaagtctgagccgggaagcgaagcagaggagtgcttcctgcgtgttccccagacggag
tatttctttgatgaggctagcgagatcaaacctcttcggtcaatgcctaacttcaaatac
ctcgaacaagactctctcatccccggtgccaaactcggagtctcattcacaaccctaacc
atcgacacccctatatacctcaactacctcctcagccggttccttgccaatggtggcaag
attcttcgcggttccgtgcagcacatcaaccaagtgatagaagctggcgcgcgcatcttc
gcgggcgggacgacggtggggcatagcgccgacccgcctgttgctgtgatcaattgtacg
gggctgggtgcgaggtttctgggtggtgtggaggataagagtgtgtatcctgtgaggggc
cagactgtgcttgtgagggcgccgtgggtgaggtttgggcgcacgacgtatagggatgat
acgggtgcctggacgtatattattcccaggaggagcagtgatgttatcgtaggagggacg
agggcccgagacgattggttccccaagcccaggccggaaaccactgaagatattctacga
cgaggcttggaattgtgtcccgagttggcaccgccggaagctcggttaggaggacgaaag
ccgacactcgaagatgttatgccgcatgttgttggggagggatgtgggctgcggcctgct
cgagaaggaggggtgaggatagagactgagtggacggaagacattggtggacggggaagg
gttcctattatccataattatggacatggcggggctggcttccaagcttcatggggctca
tcggttgtcgtacttgaattgcttgaagaggcgctttcgcaacttgagaagtcatga

DBGET integrated database retrieval system