KEGG   Clostridium clariflavum: Clocl_0117Help
Entry
Clocl_0117        CDS       T01661                                 

Definition
alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Clocl_0117
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_0117
   00620 Pyruvate metabolism
    Clocl_0117
   00650 Butanoate metabolism
    Clocl_0117
  Lipid metabolism
   00071 Fatty acid degradation
    Clocl_0117
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clocl_0117
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clocl_0117
   00626 Naphthalene degradation
    Clocl_0117
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clocl_0117
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clocl_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126460..129066
Genome map
AA seq 868 aa AA seqDB search
MIMKEAIREKDRTIDIKMEIDKLVDKAQAALERFMGFDQDKIDTIVKEMAMAGLDEHMRL
AKMAIEETGRGVFEDKSIKNIFATEYIYHSIKYDKTVGVIRENDYEDYIEVAEPVGVIAA
VTPVTNPTSTTMFKSLIAIKTRNPIIFAFHPSAQKCSAEAARIVRDAAIKAGAPEDCIQW
IEQPSIEATQMLMNHPKVALVLATGGAGMVQAAYSTGKPALGVGPGNVPCYIEKTADVKR
AATDLILSKTFDNGMICASEQAVIVDKAISKEFEKFMKENKCYFLNAEETKKLEKTAIDE
VKCAMNPAVVGQPAYKIAKMAGFEVPEDTKILISKLNGVGPEYPLSREKLSPILAYYVVD
GWEQGIRIAEEMVEFGGLGHSAVIHSEDKNVIDEFARRIKAGRLIINSPSTHGAIGDIYN
TNMPSLTLGCGSFGRNSTTANVSAVNLINKKRVARRRVNMQWFKIPEKIYFQFGSTQYLE
KMPDISKAFIVTDPYMVKLGYVDRVLYYLRKRHDYVHCEIFSEVEPDPSVDTVLKGYNLM
KKFQPDVIIALGGGSAIDAAKGMWLYYENPETDFDSLRLKFMDIRKRVFKFPKLGKKAKF
VAIPTTSGTGSEVTSFAVITDRKNNTKYPLADYELTPDVAIIDPEFVMTVPPSVTADTGM
DVLTHAIEAYVSVMASDFTDGLAIKAIQLVFEYLPRSYKNGNDKLAREKMHNASCIAGMA
FTNAFLGINHSLAHKLGGEFHIPHGRANAILLPHVIEYNASKPSKFVSFPKYETFIADKK
YAEIAKALGLPASTVEEGVQSLIKAIKDLMKELNLPMTIAECKVDKKEFLSKVPMLAEKA
FEDQCTTANPRLPLVKELEEIYIKAYGL
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaaagaagctattagggagaaagacagaacaattgatataaagatggaaata
gacaaactggtggataaagcacaggctgcactggaaaggttcatgggatttgaccaggat
aaaattgataccatagtaaaagagatggctatggcaggccttgatgaacacatgagactt
gcaaagatggctattgaggagaccggcaggggtgtgtttgaagacaagagcataaagaat
atatttgcaactgaatacatctatcacagcattaaatatgacaagacagttggagtaata
agagaaaatgattatgaagactatattgaagtggcagaacctgtaggagttattgccgca
gttaccccggttaccaatcctacttcaaccaccatgtttaaatccttaattgcaataaaa
acgagaaaccctattatatttgcatttcatccttcggctcagaaatgcagcgcggaagca
gcaagaattgtaagagatgctgccattaaggccggtgccccggaagattgcattcaatgg
attgaacagccttccatagaagctacccagatgctcatgaatcatccaaaggttgcgttg
gttcttgcaacaggaggtgctggaatggttcaggctgcatatagcaccggtaaaccagct
ctaggtgttgggccgggcaatgttccatgctatattgaaaaaactgcggatgtaaaaaga
gcagctaccgacctcattctttcaaagacttttgacaacggaatgatttgtgcctcagag
caagctgtaattgtagacaaggcaataagcaaagaatttgaaaagttcatgaaggaaaat
aaatgttatttcttaaatgcagaggagacaaagaaactggaaaaaaccgcgattgatgag
gttaaatgtgcaatgaatccggcagtggtgggtcagccggcttataaaattgctaaaatg
gcaggttttgaggtgcctgaagatacaaaaatactgatttcaaagcttaatggcgttgga
cctgagtacccgctttcaagggagaaattgagtcccatcctagcatattatgttgttgac
ggctgggaacagggaataaggattgccgaggaaatggttgagtttggcgggcttggacac
tctgcagttattcattccgaagataagaatgtaatagatgaatttgcaagaagaatcaaa
gcaggaagacttattataaattctccttcaacccatggtgcaattggagatatttacaat
acaaacatgccgtctctgacattaggctgcggatcttttggaaggaattctacaacagcc
aatgtttccgcggtaaaccttattaataagaagagagtggcaaggagaagggtcaatatg
cagtggtttaaaattcctgagaaaatatatttccagttcggttcaactcaatatcttgaa
aaaatgcccgatatatcaaaggcgtttattgtgacagacccttatatggttaagttaggt
tatgttgatagagttctgtattacttgagaaagagacatgactatgttcattgcgagata
ttctcggaggttgagcccgatccctctgtagatacggtattaaagggctacaatttgatg
aaaaagttccaacccgatgttattattgctttaggtggaggttcggcaattgatgcagcc
aagggaatgtggctctattatgaaaatcctgagactgattttgattcattgagactaaaa
tttatggatataagaaaaagggtgtttaaattccctaaactcggtaagaaagctaagttt
gttgcaatacccaccacatcgggaacaggctcggaagtgacatcttttgcagttattacc
gacaggaagaataatacaaagtatccacttgccgattatgaacttacaccggatgttgct
attattgatcctgaatttgtaatgactgttccgccatcggttacagccgataccggtatg
gatgttttgacccatgctatagaggcttatgtttcggtgatggcttcagattttacagat
ggtttggcaatcaaagctatacagttggtttttgagtatttgccaaggtcatataagaat
ggaaacgataaattggcaagagaaaaaatgcacaatgcttcatgtatagcgggaatggcc
tttactaacgcattcttgggtataaaccacagtcttgcccataaattaggcggcgagttt
catattcctcacggaagggcaaatgcgatactattacctcatgtgatagaatacaatgca
tcaaaaccgagcaagtttgtatccttcccgaaatatgagactttcatcgccgacaagaaa
tatgccgagatagcaaaggcattaggtttaccggcatctactgttgaagaaggagtacaa
agcctcattaaagcaataaaggatttgatgaaagagttaaatcttcctatgactattgca
gaatgcaaagttgacaaaaaggaatttttgtcaaaggttccgatgcttgctgaaaaggct
tttgaagaccagtgcaccacagccaaccctagattgccattagttaaggaacttgaggaa
atttacattaaagcttatggcttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system