KEGG   Clostridium clariflavum: Clocl_0282Help
Entry
Clocl_0282        CDS       T01661                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccl  Clostridium clariflavum
Brite
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clocl_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295215..299594
Genome map
AA seq 1459 aa AA seqDB search
MRRQFQKVISIMLAAILAISMGQFGQIAIASETEKDNIVLYQSFEDGDVGGWKPVWDRPG
TVAVSSDYASHGEKSLLFTDRTSTEHSPSLDITSYMEPGKIYDISLKVRLGEGSDEAHIA
SKVNSPLLDNIYPWLTGNVTISSDKWTTLEVKAYEVPDKTSEFVIYIETLNSTADIYIDE
VLIVDVTPVAEPVTVLYQSFEDGDVGGWKPVWDRPGTVAISSDYASHGEKSLLFTDRTST
EHSPSLDITSYMEPGKIYDISLKVRLGEGSDEAHIASKVNSPLLDNIYPWLTGNVTISSD
KWTTLEVKAYEVPDKTSEFVIYIETLNSTADIYIDEVLIVCISSGTTPGGDLDQSGIKSD
FEDGIGNWMIRFEESGSIELTDDDNHTPGGAKSLAASVSSQYNGPILNVMGKMHKGHKYY
LSAWVKMAPGQKPTVLRMSVQSGSSAFTNVSENVLVTENEWVQLTGTFTVAVTPSVLNAY
IETADTPDETVTFYMDDFELSYIGPVATKPVQTDLTPIKEAYKDYFLIGSAVNITDFEGD
RLKLLKHHFNVVTTENAMKPEFAYDKDKKFDFEEENVLVSKIEQEGLQLVGHVLVWHSQM
PTWLSTAEDGKPLDRETAYKNLETHIKTVIENYGDKVISWDVVNEAIRDGLTFTATTENW
KDALRDTPWLRALGPDYVEESFKIARKVLEDNGWTNVKLYYNDYNEDNQQKAAAIYSMVK
DINERYAKQNGGKILIDGIGMQSHYNSSTNPENVRLTLEKFSSLEGVEISITELDITAGI
NSVLTDEQAKAQGYLYAQLFKLYKQYADKIARVTFWGLNDSTSWRKEGSPLLFDEYLQAK
PAYYAIIDPDKFIKENPPPEKVVKQAKALYGTPVIDGEVDSIWYNTYNIKIDQYQQEFEG
ATGVAKALWDEENLYVLIQVQDDALDDKNANAWEQDSVEIFVDQNNAKTPYYEEEGDGQY
RVNFNNVATFNPDSIKEGFESATSVTGTNYIVEVKIPLKTITPAKGTKIGFDLQINDAEN
GKRVSAAAWNDTTGTAYMDTSVFGELTLDKATGSGTGGSKGSGGGSSNVPETTETGSGNE
TTNNTGIITVEATVDENGNYTAVVDEKLVENVKDEKIKIEVKGAEQANNVIVKVAYDLIS
AASGANAKVIEVNTGLANIELPVSLFSGSKEGEEVELQVNKVDNSRLPEKVRTRVGQNTV
FEFSLSVGGQKLSTFDETQKVKVSYPYTLEAGVRPSRVVVYYINENGEFEVIKNGRYSNG
AIHFKTKHFSKYVAVPVEVNLKDIYETTWATDSIEALAAREIVKGVSADSFLPMKEVTRA
EFVQMIVETFDLKSEAVINPFSDVVEGEWYEKAVLTAYELGIVKGKPDGTFGVNEKITRQ
DMVVITYSALKVSGININTTTKAVIFKDDTLISEYAKEAVAAMQRAGIINGMPGNLFAPK
DTANRAQAAVILNKLLDEL
NT seq 4380 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagacaatttcaaaaagttatttctatcatgctagcagctattttggctatttcg
atggggcagtttggacagatagcgatagcatcggaaactgaaaaagacaacattgtgttg
taccagagctttgaagatggagatgtaggtggatggaagccggtatgggatagaccggga
acagtagctgtatcttctgattatgcttcgcatggagaaaaatcccttttattcacggac
agaacatcgactgaacattctccaagtcttgacataactagctatatggaacctgggaaa
atatatgatatatctttgaaggtgagattaggagaaggcagcgatgaagcccatatagca
tcgaaggtaaattcgccattactggataatatatatccttggttaacaggtaatgtaacg
attagttctgataaatggacaactcttgaagtcaaagcctatgaagtaccggacaaaaca
tctgaatttgtcatttacattgagactcttaattctacagcagatatatacattgacgaa
gtattgatagtggatgttacacctgttgcagaacctgtgactgtattatatcaaagcttt
gaagatggagatgtaggtggatggaagccggtatgggatagaccgggaacagtagctata
tcttctgattatgcttcgcatggagaaaaatcccttttattcacggacagaacatcgact
gaacattctccaagtcttgacataaccagctatatggagcctgggaaaatatatgatata
tctttgaaggtgagattaggagaaggcagcgatgaagcccatatagcatcgaaggtaaat
tcgccattactggataatatatatccttggttaacaggtaatgtaacgattagttctgat
aaatggacaactcttgaagtcaaagcctatgaagtaccggacaaaacatctgaatttgtc
atttacattgagactcttaattctacagcagatatatacattgacgaagtattgatagta
tgtatttcatccggtacaactccaggaggcgaccttgatcaatctggaattaaatctgat
ttcgaagacggtatcggcaattggatgatcagatttgaagagagtggaagcattgaattg
acagatgacgacaatcatacaccgggtggagcaaaaagtctggcagcaagtgtttcttcc
cagtataatggtcctattttaaatgttatgggtaaaatgcacaaagggcataaatattat
ttgtctgcctgggtaaaaatggctcctggtcaaaagccgactgtactacgcatgagcgta
cagagcggaagcagcgcatttacaaatgtttctgagaatgtattggtgacagaaaatgag
tgggtgcagttaaccggtactttcacagtggcggttactccaagcgtattaaatgcatat
atagaaacagcagatacaccagatgagacagtaactttctacatggatgactttgaactt
tcgtatattggcccggtagctacaaaacctgtacaaactgatttaactcctataaaggag
gcttacaaagattacttcttaattggtagtgcagttaatattacagattttgaaggtgat
agacttaaacttcttaaacatcatttcaatgttgttacgacagaaaatgcaatgaagcct
gaatttgcttatgataaagataagaaatttgactttgaagaggaaaatgttcttgtatca
aaaattgaacaagaaggtttgcaattggtaggtcacgtacttgtatggcacagccaaatg
cctacatggttaagtacggctgaggatggtaaaccgttagatcgtgagacagcgtataaa
aacttggaaactcatatcaagacagttatagagaattacggtgacaaggttatttcctgg
gatgtagtaaatgaagctatcagagatggcttgacatttactgctaccactgaaaattgg
aaggatgcactccgtgacacgccttggttaagggctcttggtcctgattatgttgaagag
tctttcaagattgcaagaaaagtgttggaagataacggatggacaaatgtaaaactgtat
tataacgattacaacgaagataaccagcaaaaagcagcagcaatctatagcatggttaaa
gatatcaatgaaagatatgctaaacaaaatggtggcaagatactaattgacggtatagga
atgcagtctcattataacagcagcacaaacccggaaaatgttcggcttaccttagagaaa
ttcagctctctggaaggagttgaaataagtataactgagcttgacatcacagctggaatc
aattcagtattgactgatgaacaggctaaggcacagggatacttatatgctcaactgttt
aaactctataaacagtatgctgacaagatagcccgtgtaactttctggggattaaacgac
tctaccagttggagaaaagaaggcagtccattgttgtttgatgaatacttgcaggctaaa
ccagcttactatgctatcatagatccggataaatttattaaagaaaatccgcctcctgaa
aaggtggttaaacaggcgaaggctttatacggaactcctgttattgacggtgaagtggat
tccatatggtataacacatataatataaagattgatcaatatcaacaggaatttgagggt
gctactggtgtggctaaagcactttgggatgaagaaaacctctatgtactgatacaggtt
caagatgatgctcttgatgataaaaatgcaaatgcttgggaacaagactctgttgagata
tttgttgaccaaaataatgctaaaacaccttattacgaagaagagggagatggacagtac
agagtaaactttaacaatgtagctacctttaatcccgatagcataaaggaaggatttgaa
tcagcgacaagtgtaacaggaacaaactatatagtagaagtgaagattccgttaaaaaca
ataactccggctaaaggcactaaaatcggttttgatcttcaaatcaacgatgcggaaaat
ggtaaacgtgtaagtgctgctgcctggaacgatacaacgggtactgcctacatggataca
tctgttttcggtgagttgactttggataaagcaactggttcaggcacaggtggttcaaag
ggaagcggcggtggaagcagcaatgtgccggaaactactgaaaccggaagtggcaacgaa
acaacaaataacactggtataataacagtagaagcaactgtggacgaaaatggaaattat
actgctgttgtggatgaaaaattggtggaaaacgttaaagatgaaaaaataaaaatagaa
gttaagggtgcagaacaggctaataatgtaatagtgaaagttgcttatgatctcattagt
gcggcatcaggtgctaatgccaaggtaatagaagtaaataccggtttggctaatatagag
ttgccggtatccctgtttagcggttctaaagagggagaagaggttgaattgcaagtaaat
aaagttgacaattctcggctcccagaaaaggtaaggacaagggtagggcaaaatacagta
tttgaatttagcctgagtgtaggcggacaaaaacttagtacatttgatgaaacacaaaaa
gtaaaagtatcttacccatatactctagaagcaggagtaagaccgtcaagggttgtagtt
tactatattaacgagaacggcgagtttgaagtaataaagaatggtcgttacagcaatggt
gcaattcactttaaaacaaaacatttcagtaaatatgtggctgtaccggttgaggtaaac
ctcaaggacatatatgagacaacatgggcaacagacagtatagaagctttagcagcccgt
gaaattgttaaaggggtatcggctgattccttcctgccgatgaaggaagtaacaagagca
gagtttgtgcaaatgatagttgagacctttgatttgaaatcggaagctgtaataaatcca
ttctcggacgttgttgaaggcgaatggtatgaaaaagcagttttaactgcctatgaatta
ggtatcgttaaaggcaaacctgatggaacctttggggtgaatgagaaaatcacccgtcaa
gatatggtagttattacatacagtgcattaaaagtatcagggattaatataaatactact
acaaaagctgttatatttaaagatgatacgcttatatcggaatacgcaaaagaagctgtg
gcagcaatgcaaagagctggaatcatcaatggtatgcccggtaacttatttgcgccaaag
gatactgcaaacagagcgcaggctgcagtaattctgaataaattgcttgatgaactgtaa

DBGET integrated database retrieval system