KEGG   Clostridium clariflavum: Clocl_0788Help
Entry
Clocl_0788        CDS       T01661                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccl  Clostridium clariflavum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Clocl_0788
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Clocl_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(908131..909036)
Genome map
AA seq 301 aa AA seqDB search
MKILCFGSLNLDNVYQVDHIVQPGETTTSISYQLFDGGKGLNQALALGRANAKCSMAGMI
GRDGIHLLKTLEQSNVNADFVAVNENTNTGSTIIQVDKNGQNSIIVVGGANQMIDEAFVK
HVISHFESGDFILLQNEINNIPLIMKEAKQKGLKIAFNPSPITGELFNYPLDLVDILILN
EIEGYELTREKDYANIIKRLHELYPKTSLLLTLGKKGALFSDGVNIYRHGIYDVKVVDTT
AAGDTFTGYFLASYANNEPIEECLRKASIASSLAVSRPGASSSIPFLSEVLNSNLILVNY
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttatgtttcggttctttaaatctggacaacgtttatcaagttgaccatatt
gtacaacctggagaaacaaccacttccatatcctatcagctctttgacggcggaaaagga
ttaaaccaggccctggctttaggcagagccaatgcaaaatgcagcatggccggcatgata
ggccgtgacggtattcacttgttaaaaactttagaacaaagcaatgtaaacgctgacttt
gttgcagttaatgaaaacaccaatacgggcagtacaatcatacaggttgataaaaacggt
caaaactccatcattgttgttgggggcgccaaccaaatgattgatgaagcctttgttaaa
catgttatatctcattttgaatcaggagactttattttattgcaaaatgagatcaacaat
atcccccttatcatgaaagaagcaaagcagaagggattgaaaatcgctttcaatccgtca
cccattaccggggaactgtttaattaccctttagaccttgttgatatcttaattttaaat
gaaattgaaggatatgaattaaccagggaaaaagattatgcaaacataatcaaacgactt
catgaactctatcctaaaacatcactccttttgactttgggtaaaaaaggtgctctgttt
agcgatggtgtaaatatttacagacatggtatttatgatgtaaaagttgtagatacgaca
gctgccggtgatacctttaccggttatttcctcgcatcatatgccaataacgagcctatt
gaagaatgtttgcgtaaagcttctatcgcttcatctttggctgtttcaagacccggtgca
tcatcatccattcctttcttgtctgaagtacttaacagtaatttgatcttagttaattat
gagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system