KEGG   Clostridium clariflavum: Clocl_0923Help
Entry
Clocl_0923        CDS       T01661                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ccl  Clostridium clariflavum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clocl_0923
   00500 Starch and sucrose metabolism
    Clocl_0923
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Clocl_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1068026..1069771
Genome map
AA seq 581 aa AA seqDB search
MMKRLLVLLIVLGMAFSIYPNSGLAADDVSAMYGDLNGDGSVNSIDYAIMKSYLIGIRSN
FPVLNGEVVGDVNADNSVNSIDYAFIKSYLLGLISEFPAEKTRPLTTPAPQEEAIYEAED
AALYNSFLETIHSGFSGSGYVNYNNEYGSYVEWKVNVAKNGAYKLIFRYANGANTNRAMS
ISVNKKIARNSLDFNPTGSWTGWSESYIVVKLDQGDNLIRATAITADGGPNVDYLKVMST
NEPVMTPDPTTAQTPAPTPKNETPVPSSSTTIPAGAIIVDKSGRGNYTTVQAAVNSLGSK
SSDAKTIYIKNGNYKEVVTIPNGISNLTIIGESKENVIIHYDNYNGKSNGSGGTYGTSGS
ASVFIKGSDITVHNITFMNSFEEKGNSNEQAVALSATGNRIKFNNCIFRGNQDTLLCDGG
TQYFYKCLIEGDVDFIFGRSQAVFEECEIRSLNRGSKTNNGYITAARTDASAPYGFVFIN
CRLTCEWGTAANSVWLGRPWCPNGTDVNKPAVAYINCYMDAHIKTEGWTSMSGVDPSHGR
FYEYNSWGSGAAKNSSRPQLTAAQAANYTKINVLGGWNPSF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaggttactggtgcttttaattgtattgggaatggcttttagcatatatccg
aacagcggattggcagccgatgatgtttctgcaatgtacggggaccttaatggagatggc
agtgtaaattcaatagattatgcaataatgaagtcttatcttataggaattagatccaac
tttcctgttttaaacggggaagtggttggcgatgttaacgcagataattcagtgaattca
atagattatgctttcattaaaagttatcttttgggattaatctccgaatttccggccgaa
aaaactagacctttgacaacgcctgcacctcaagaagaagcaatatatgaggcagaggat
gctgcactttacaattcttttttggagactatccattccggtttttccggcagcggttat
gtaaattacaataatgaatacggaagttatgtggagtggaaggttaatgttgctaaaaac
ggggcttataaacttattttcagatatgcaaatggagcaaataccaaccgggctatgtca
ataagtgttaataaaaagattgcacggaacagtttggattttaatccgacaggttcatgg
acaggctggagcgaaagctatattgtagttaaacttgaccaaggagacaacttaatcagg
gccacagctattactgccgacggaggaccgaatgttgattatttaaaagtaatgtcaacc
aatgaacctgttatgacacctgacccgacaacagctcagacacctgcaccaacaccgaaa
aacgaaactcctgttccaagttcttctacaactattccagctggagcaattattgtagat
aaaagcggcagaggtaattatacaacggttcaggctgccgtaaatagcttaggatcaaaa
agttccgatgccaaaactatttacataaagaacggaaattataaagaggttgttacaata
cctaatggaatttcaaaccttaccattataggagaatctaaagaaaatgttattattcac
tatgataattacaacggaaaaagcaatggcagtggagggacttatggcaccagcggaagt
gcttcggtatttataaagggcagtgatattactgttcacaatattacctttatgaattcc
tttgaagaaaagggaaacagcaatgaacaggcagttgccctcagtgcaaccggtaacagg
attaaatttaacaattgtattttccgcggtaaccaggatacattattgtgtgatggtggt
acacaatatttctataaatgcctgattgaaggagatgttgactttatattcggacgcagc
caggcggtatttgaagaatgcgaaatccgttcgttaaacagaggcagtaaaaccaataac
ggatatatcacagcagcaagaacagacgcttcagcaccctatggttttgtatttatcaat
tgcagattaacctgtgaatggggcacagcagcaaacagcgtatggcttggcagaccatgg
tgcccgaacggtactgatgtaaataaacctgcagtggcttatatcaattgctacatggat
gcacatatcaagacagaaggatggacatcaatgtcgggagttgacccgtcccatggacgt
ttctatgaatataacagctggggaagcggtgctgctaaaaatagttcaaggcctcagttg
actgcggcccaggcagcaaattatacaaagattaatgtattgggcggttggaatccgagt
ttttag

DBGET integrated database retrieval system