KEGG   Clostridium clariflavum DSM 19732: Clocl_0924Help
Entry
Clocl_0924        CDS       T01661                                 

Definition
helicase, putative, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070071..1072221
Genome map
AA seq 716 aa AA seqDB search
MEYLSGVVERITYVNEENGFCVIKIKSHGFSDLVTVVGNLAAVNVGSTLKLKGNWKFDSK
YGRQFNAIDYQETVPATIAGIEKYLGSGLIKGIGPVYARRIVKHFKEDTLRVIEENPDAL
LEVEGIGQKRVDMIKKAWAEQKEIKNVMLFLQSNGVSTAYAVKIYKTYGNESINIVKSNP
FRLADDIWGIGFKTADKIAQQLGFEKNSFERCKSGIIYVLNELSNDGHCYLKREQLVAEA
VKMLEAEESLVNATLDRMIEEKIVIFDEDNAVYLPTLYYCETGVAKRIREILSEKSKISA
INIDRIVTRIQEEYNISYDEVQLEAIRTAAASKFMVLTGGPGTGKTTTTLAIIKVYQKMG
LKVLLAAPTGRAAKRMSETTGMEAKTIHRLLEFKPAEGYQKNSENPLDCDVLIIDETSMV
DIVLMYNLLKAVANETIVILVGDVDQLPSVGAGNVLKDIIDSGIVKVIKLTRIFRQALGS
AIITNAHRINKGEMPILKGGRNSDFFYIQEEEPTKIAETIKSLCSKRLPDYYKVDPINDI
QVLCPMQRGEVGAQNLNNILQEALNPGDVTIKYGGTIYRLKDKVMQVKNNYDKNVFNGDI
GIISRIDMEDKTVTISFDGNEVEYDATELDEIVLAYATTVHKSQGSEYRIVVAPFTMQHY
MMLQRNLLYTCVTRAKSVFVLVGSKKAIGIAVSNSKIQQRNTMLAKRLQEENKATM
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggaatatttaagtggagttgttgaacgaattacatatgtaaatgaggaaaacgggttt
tgtgtcataaaaataaaatcccatggtttttctgaccttgtaaccgttgtggggaatctt
gcggccgttaatgtcggttcaacacttaagttaaaaggaaactggaagtttgacagcaaa
tacggcaggcagtttaatgccattgactatcaggagacagttccggctaccatagcaggg
atagagaaatacctgggcagcggcctgataaaaggcataggtcctgtttatgcccgtcgc
attgtcaaacattttaaggaagataccctccgagtaatagaagaaaatcccgatgctctg
cttgaagtggaaggcattgggcaaaaacgggtggatatgattaaaaaagcctgggcggaa
cagaaagaaataaaaaacgttatgctctttctccaaagcaatggggtatcgacggcctat
gctgtaaaaatatataagacttatggaaatgagagtataaacatcgttaaaagcaaccct
ttccggcttgctgacgatatatggggaatcggttttaaaaccgctgataagatagctcaa
cagcttggttttgagaaaaactcctttgaacgttgcaagtcggggattatttatgtgctg
aacgagctttcgaatgacggacattgttatttaaaaagggaacagcttgtggctgaagca
gtgaagatgctcgaagcagaagagagtttagtaaatgccacccttgacaggatgattgag
gagaaaattgtaatattcgatgaagataatgccgtttatcttcccaccctttattactgt
gagaccggtgttgccaaaagaattagggaaattctctctgagaaaagcaaaatatcagca
attaatattgatcggatagttacccggatccaggaggaatacaatatatcctatgatgaa
gttcagttggaggctattagaactgcagctgcttcaaagttcatggtattaaccggagga
cccggtacagggaaaactacaactaccttggctattattaaagtatatcaaaagatggga
ttgaaggttttgctggcagcacctacaggccgtgcagctaaaagaatgtctgaaactaca
ggcatggaagctaagaccatccatcgtcttcttgaattcaaaccggctgaaggataccaa
aaaaattctgaaaatcctttagattgcgatgtattgattattgatgaaacttctatggtg
gatattgttctaatgtacaaccttttaaaagctgtggccaatgaaacaattgtgattttg
gtgggggatgtggatcaactgccgtcagtgggagcgggaaatgtactcaaggatataatc
gattccggtattgtaaaggttatcaaactaacgaggattttccgccaggctttgggaagt
gccattataacaaatgcccatagaattaacaagggagagatgcccatattaaaaggtggg
cgaaacagtgattttttctacattcaggaagaagaaccgactaaaattgctgagacaata
aaaagcctgtgttccaaacgtttacccgattattataaggttgatcccataaatgacata
caggtgctgtgtccaatgcagagaggggaagtgggggcacaaaacctcaacaatatcttg
caggaagctttaaatcccggtgatgtgacaataaagtacggcggtacgatataccgctta
aaggacaaagttatgcaggttaaaaataattacgacaaaaatgtctttaatggtgatata
ggtataataagcagaattgatatggaggacaaaacggtaacaataagttttgacggaaat
gaagtagagtacgatgccaccgaactggatgagattgtgctggcctatgccactactgta
cataaaagccagggcagtgaatacagaatagtagtagccccctttacaatgcagcattac
atgatgctgcaaagaaatttgttatatacatgtgtgaccagagccaaaagtgtattcgta
ctggtgggctcaaaaaaagcaataggaattgccgtgtccaacagtaaaatacaacagcgc
aatacaatgctggcaaaaaggcttcaagaagagaacaaagcgacaatgtaa

DBGET integrated database retrieval system