KEGG   Clostridium clariflavum: Clocl_0966Help
Entry
Clocl_0966        CDS       T01661                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccl  Clostridium clariflavum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocl_0966
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocl_0966
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocl_0966
Enzymes [BR:ccl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocl_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1122046..1123230
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGKHGGQYVPETLMNALIELEEAYNHFKDDPEFNRELINLFNNYAGRPSLLYYAE
KMTKDLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKKMGKTRVIAETGAGQHGVATATA
AALMGLECEIFMGKEDTERQALNVYRMELLGAKVHAVTSGTQTLKDAVNETMREWTKRVS
DTHYVLGSVMGPHPFPTIVRDFQSVIGREVKQQIMQKEGRLPDVVLACVGGGSNAMGIFY
NFIEDKSVRLIGCEAAGHGVDSGKTAATIATGKLGIFHGMKSYFCQDEYGQIAPVYSISA
GLDYPGIGPEHANLHDMGRAEYVPVTDAEAVEAFEYLSRVEGVIPAIESAHAVAYAKKIA
PGMNKDQIIVICLSGRGDKDVAAIARYRGVNIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaagattcggaaaacatggtggtcagtatgttccggaaacattgatgaat
gcattgattgaacttgaggaagcttataatcattttaaggatgatccggaatttaatagg
gaactgatcaatttgttcaataattatgcaggccgtccgtcgcttttgtattatgcggaa
aaaatgactaaagatttgggtggtgccaagatttatctaaaaagagaggatctcaatcat
accggttcgcataaaattaacaatgtactgggacaggtgcttttggcaaaaaagatgggg
aaaacccgtgttattgcagaaacgggtgccggacagcacggtgttgctacagccactgca
gcagctcttatgggccttgaatgcgagatattcatgggtaaggaggatacggaacgacag
gcgctaaatgtttaccgtatggaacttctgggtgcaaaggttcatgcagtgactagcgga
actcaaacactaaaggatgcagtaaatgaaaccatgcgtgaatggacaaaacgtgtcagt
gatactcattatgtattgggatctgtaatgggacctcatcccttccccacaattgtgcgt
gattttcaaagtgtaataggccgtgaagtcaagcagcagataatgcaaaaggaaggacgg
cttcccgatgtggttttggcatgtgttggaggcggcagtaatgcaatgggaatattctat
aactttatagaagataaaagtgtgcgattaattggatgcgaggcagcaggacatggtgtt
gacagcggtaagacagcagcaacaatagccaccggtaagttgggaatattccacggaatg
aagtcatatttctgccaggatgagtatggtcagattgcacccgtatattcaatttcagca
ggtcttgactatcccggtatcggtccggaacatgcaaatttacacgatatgggcagggcg
gaatatgttcctgttacagatgctgaagctgtagaagcttttgaatacctgtcacgggtt
gagggagttataccggctatagagagtgcgcatgccgttgcctatgctaaaaaaattgca
ccaggcatgaataaagatcaaattattgtaatttgcctatccggaagaggagataaggat
gttgctgctatagcacgttacaggggggttaatatatatgaatag

DBGET integrated database retrieval system