KEGG   Clostridium clariflavum: Clocl_0966Help
Entry
Clocl_0966        CDS       T01661                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00260  Glycine, serine and threonine metabolism
ccl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01130  Biosynthesis of antibiotics
ccl01230  Biosynthesis of amino acids
Module
ccl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocl_0966
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocl_0966
Enzymes [BR:ccl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocl_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEV67643
UniProt: G8LWZ1
Position
1122046..1123230
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGKHGGQYVPETLMNALIELEEAYNHFKDDPEFNRELINLFNNYAGRPSLLYYAE
KMTKDLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKKMGKTRVIAETGAGQHGVATATA
AALMGLECEIFMGKEDTERQALNVYRMELLGAKVHAVTSGTQTLKDAVNETMREWTKRVS
DTHYVLGSVMGPHPFPTIVRDFQSVIGREVKQQIMQKEGRLPDVVLACVGGGSNAMGIFY
NFIEDKSVRLIGCEAAGHGVDSGKTAATIATGKLGIFHGMKSYFCQDEYGQIAPVYSISA
GLDYPGIGPEHANLHDMGRAEYVPVTDAEAVEAFEYLSRVEGVIPAIESAHAVAYAKKIA
PGMNKDQIIVICLSGRGDKDVAAIARYRGVNIYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaagattcggaaaacatggtggtcagtatgttccggaaacattgatgaat
gcattgattgaacttgaggaagcttataatcattttaaggatgatccggaatttaatagg
gaactgatcaatttgttcaataattatgcaggccgtccgtcgcttttgtattatgcggaa
aaaatgactaaagatttgggtggtgccaagatttatctaaaaagagaggatctcaatcat
accggttcgcataaaattaacaatgtactgggacaggtgcttttggcaaaaaagatgggg
aaaacccgtgttattgcagaaacgggtgccggacagcacggtgttgctacagccactgca
gcagctcttatgggccttgaatgcgagatattcatgggtaaggaggatacggaacgacag
gcgctaaatgtttaccgtatggaacttctgggtgcaaaggttcatgcagtgactagcgga
actcaaacactaaaggatgcagtaaatgaaaccatgcgtgaatggacaaaacgtgtcagt
gatactcattatgtattgggatctgtaatgggacctcatcccttccccacaattgtgcgt
gattttcaaagtgtaataggccgtgaagtcaagcagcagataatgcaaaaggaaggacgg
cttcccgatgtggttttggcatgtgttggaggcggcagtaatgcaatgggaatattctat
aactttatagaagataaaagtgtgcgattaattggatgcgaggcagcaggacatggtgtt
gacagcggtaagacagcagcaacaatagccaccggtaagttgggaatattccacggaatg
aagtcatatttctgccaggatgagtatggtcagattgcacccgtatattcaatttcagca
ggtcttgactatcccggtatcggtccggaacatgcaaatttacacgatatgggcagggcg
gaatatgttcctgttacagatgctgaagctgtagaagcttttgaatacctgtcacgggtt
gagggagttataccggctatagagagtgcgcatgccgttgcctatgctaaaaaaattgca
ccaggcatgaataaagatcaaattattgtaatttgcctatccggaagaggagataaggat
gttgctgctatagcacgttacaggggggttaatatatatgaatag

DBGET integrated database retrieval system