KEGG   Clostridium clariflavum: Clocl_0967Help
Entry
Clocl_0967        CDS       T01661                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00260  Glycine, serine and threonine metabolism
ccl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01130  Biosynthesis of antibiotics
ccl01230  Biosynthesis of amino acids
Module
ccl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocl_0967
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocl_0967
Enzymes [BR:ccl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocl_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Transpeptidase His_biosynth BtpA ThiG
Motif
Other DBs
NCBI-ProteinID: AEV67644
UniProt: G8LWZ2
Position
1123223..1123993
Genome map
AA seq 256 aa AA seqDB search
MNRIEQVFKNRKAFIPFITAGDPSLDITEKLVLKMAEAGSDLIELGIPFSDPIAEGPVIQ
EADNRALEAGTTTDKVFDMVKSIRRSCNVPIAFMTYANPIFTYGTDEFMKKCQEVGVDAV
IVPDIPYEEKGELLPYCSKYNVTFISMIAPTSNERIRKIAAEAEGFIYCVSSMGVTGVRE
KLGDNIEEMIKIAKEVKDIPCAIGFGISTPEQAAAMSKISDGVIVGSAIVKIIAQYGFEC
VPHVEEYVKSMIKAIR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagaacaggtttttaaaaacagaaaggcatttattccgttcattactgca
ggagacccgtcactggatataacggaaaagttagtgcttaaaatggctgaggcaggatcc
gatttgattgagttgggtatacccttttctgaccccattgcagaaggtccggttatacag
gaagcggataatagagcattggaggctggaactactaccgataaagtgtttgatatggta
aaaagtattcgcaggtcatgtaatgttccaatagcatttatgacctatgcaaatccgatt
tttacttacggtactgatgaatttatgaagaaatgtcaggaagtaggggtggatgcagta
attgttcctgatattccttatgaggaaaaaggggaacttttgccctattgctcaaaatat
aatgttactttcatatccatgattgcaccgacgtctaatgaacgcattcgcaaaatagca
gcagaagcagaaggttttatatattgtgtttcctcaatgggtgtaacgggagtaagagaa
aaactgggagacaatatcgaagaaatgataaaaattgcaaaagaagttaaagatattccg
tgtgcaattggctttggaatatcgacaccggagcaggcggcagccatgagcaaaatttcc
gatggtgtaattgttggaagtgcaattgtaaaaattattgcccagtatggttttgagtgt
gtaccccatgttgaggagtatgtaaaaagtatgataaaagccataagatag

DBGET integrated database retrieval system