KEGG   Clostridium clariflavum: Clocl_1150Help
Entry
Clocl_1150        CDS       T01661                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00010  Glycolysis / Gluconeogenesis
ccl00030  Pentose phosphate pathway
ccl00051  Fructose and mannose metabolism
ccl00052  Galactose metabolism
ccl00680  Methane metabolism
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01120  Microbial metabolism in diverse environments
ccl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_1150
   00030 Pentose phosphate pathway
    Clocl_1150
   00051 Fructose and mannose metabolism
    Clocl_1150
   00052 Galactose metabolism
    Clocl_1150
  Energy metabolism
   00680 Methane metabolism
    Clocl_1150
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocl_1150
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Clocl_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEV67822
UniProt: G8LY91
Position
1341060..1342145
Genome map
AA seq 361 aa AA seqDB search
MIKRIGVLTGGGDCPGLNAVLRAVVKTAIVKYGYEVIGFKDGFKGLVDNKFVKLELDDVS
GLLDRGGTILGTSNKHNPFKFPVNVDGNTEYKDMSKRVLENLDMFGIDCMVFIGGDGTLT
TARDLMKMGIKGIGVPKTIDNDLSGTDTTFGFMTAVYTATEAIDKLHSTAESHHRVMILE
VMGRYAGWIALEAGISGGADVILIPEIPYDINKVAQKVMERKNRGKSFSIIVVAEGAKDV
EGDMVVNKVVEDSPDPIRLGGVGNKIAAEIERITGIESRVTVLGHLQRGGTPVPYDRILS
TRYGVHAVELINQGKFGMMVSLKGNRITEVPIEEAVGTLKTVDPDGELVKIAKSLGVGFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagaataggtgtacttacgggtggtggagattgcccgggattaaatgctgtt
ttgagagctgtggttaaaactgcaatagtcaaatacggttatgaggttataggatttaaa
gacggatttaaagggttggttgataataaatttgtcaagcttgaattggatgacgtttcc
ggacttcttgaccggggcggtacaattttgggtacatccaacaaacataatccttttaaa
tttccggtaaatgtagatggaaatacagaatataaagatatgtccaaaagggtgctggaa
aacctggacatgtttggaattgattgtatggtgtttattggaggagacggtacgctgact
acagcaagggatctgatgaaaatgggaattaaaggaataggtgtaccgaaaacaattgac
aatgacttgtccgggactgacacaactttcggatttatgacggcagtatatacagctact
gaagctatagacaagctccactccacggctgaatcccaccatagagtaatgattcttgag
gttatgggaagatatgccggttggatagcgttagaagcaggtatttccggtggggcagac
gttattttgattcccgaaataccctatgatataaataaagtggctcaaaaagttatggaa
agaaagaatcgcggcaaaagtttcagtattattgttgttgcagaaggtgcaaaagatgtt
gaaggcgatatggtggtcaataaggttgtcgaagacagtcccgatccaattagacttggg
ggagtaggtaataaaattgctgcagaaatagaaagaattaccggaattgaatctagagtc
acagtattgggacacctgcaaagaggcgggacaccggtgccttacgacagaatactatcg
accaggtatggcgttcacgctgtggaactgattaatcagggaaaattcggtatgatggta
agtctaaagggaaacagaattacagaggtaccgatagaggaggctgttggcactttgaag
acagtggatcccgatggagaactggtaaaaatagcgaaaagccttggggtgggttttggc
gattaa

DBGET integrated database retrieval system