KEGG   Clostridium clariflavum: Clocl_1150Help
Entry
Clocl_1150        CDS       T01661                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_1150
   00030 Pentose phosphate pathway
    Clocl_1150
   00051 Fructose and mannose metabolism
    Clocl_1150
   00052 Galactose metabolism
    Clocl_1150
  Energy metabolism
   00680 Methane metabolism
    Clocl_1150
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocl_1150
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Clocl_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1341060..1342145
Genome map
AA seq 361 aa AA seqDB search
MIKRIGVLTGGGDCPGLNAVLRAVVKTAIVKYGYEVIGFKDGFKGLVDNKFVKLELDDVS
GLLDRGGTILGTSNKHNPFKFPVNVDGNTEYKDMSKRVLENLDMFGIDCMVFIGGDGTLT
TARDLMKMGIKGIGVPKTIDNDLSGTDTTFGFMTAVYTATEAIDKLHSTAESHHRVMILE
VMGRYAGWIALEAGISGGADVILIPEIPYDINKVAQKVMERKNRGKSFSIIVVAEGAKDV
EGDMVVNKVVEDSPDPIRLGGVGNKIAAEIERITGIESRVTVLGHLQRGGTPVPYDRILS
TRYGVHAVELINQGKFGMMVSLKGNRITEVPIEEAVGTLKTVDPDGELVKIAKSLGVGFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagaataggtgtacttacgggtggtggagattgcccgggattaaatgctgtt
ttgagagctgtggttaaaactgcaatagtcaaatacggttatgaggttataggatttaaa
gacggatttaaagggttggttgataataaatttgtcaagcttgaattggatgacgtttcc
ggacttcttgaccggggcggtacaattttgggtacatccaacaaacataatccttttaaa
tttccggtaaatgtagatggaaatacagaatataaagatatgtccaaaagggtgctggaa
aacctggacatgtttggaattgattgtatggtgtttattggaggagacggtacgctgact
acagcaagggatctgatgaaaatgggaattaaaggaataggtgtaccgaaaacaattgac
aatgacttgtccgggactgacacaactttcggatttatgacggcagtatatacagctact
gaagctatagacaagctccactccacggctgaatcccaccatagagtaatgattcttgag
gttatgggaagatatgccggttggatagcgttagaagcaggtatttccggtggggcagac
gttattttgattcccgaaataccctatgatataaataaagtggctcaaaaagttatggaa
agaaagaatcgcggcaaaagtttcagtattattgttgttgcagaaggtgcaaaagatgtt
gaaggcgatatggtggtcaataaggttgtcgaagacagtcccgatccaattagacttggg
ggagtaggtaataaaattgctgcagaaatagaaagaattaccggaattgaatctagagtc
acagtattgggacacctgcaaagaggcgggacaccggtgccttacgacagaatactatcg
accaggtatggcgttcacgctgtggaactgattaatcagggaaaattcggtatgatggta
agtctaaagggaaacagaattacagaggtaccgatagaggaggctgttggcactttgaag
acagtggatcccgatggagaactggtaaaaatagcgaaaagccttggggtgggttttggc
gattaa

DBGET integrated database retrieval system