KEGG   Clostridium clariflavum: Clocl_1150Help
Entry
Clocl_1150        CDS       T01661                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocl_1150
   01230 Biosynthesis of amino acids
    Clocl_1150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_1150
   00030 Pentose phosphate pathway
    Clocl_1150
   00051 Fructose and mannose metabolism
    Clocl_1150
   00052 Galactose metabolism
    Clocl_1150
  Energy metabolism
   00680 Methane metabolism
    Clocl_1150
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocl_1150
Protein phosphatases and associated proteins [BR:ccl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clocl_1150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341060..1342145
Genome map
AA seq 361 aa AA seqDB search
MIKRIGVLTGGGDCPGLNAVLRAVVKTAIVKYGYEVIGFKDGFKGLVDNKFVKLELDDVS
GLLDRGGTILGTSNKHNPFKFPVNVDGNTEYKDMSKRVLENLDMFGIDCMVFIGGDGTLT
TARDLMKMGIKGIGVPKTIDNDLSGTDTTFGFMTAVYTATEAIDKLHSTAESHHRVMILE
VMGRYAGWIALEAGISGGADVILIPEIPYDINKVAQKVMERKNRGKSFSIIVVAEGAKDV
EGDMVVNKVVEDSPDPIRLGGVGNKIAAEIERITGIESRVTVLGHLQRGGTPVPYDRILS
TRYGVHAVELINQGKFGMMVSLKGNRITEVPIEEAVGTLKTVDPDGELVKIAKSLGVGFG
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgataaagagaataggtgtacttacgggtggtggagattgcccgggattaaatgctgtt
ttgagagctgtggttaaaactgcaatagtcaaatacggttatgaggttataggatttaaa
gacggatttaaagggttggttgataataaatttgtcaagcttgaattggatgacgtttcc
ggacttcttgaccggggcggtacaattttgggtacatccaacaaacataatccttttaaa
tttccggtaaatgtagatggaaatacagaatataaagatatgtccaaaagggtgctggaa
aacctggacatgtttggaattgattgtatggtgtttattggaggagacggtacgctgact
acagcaagggatctgatgaaaatgggaattaaaggaataggtgtaccgaaaacaattgac
aatgacttgtccgggactgacacaactttcggatttatgacggcagtatatacagctact
gaagctatagacaagctccactccacggctgaatcccaccatagagtaatgattcttgag
gttatgggaagatatgccggttggatagcgttagaagcaggtatttccggtggggcagac
gttattttgattcccgaaataccctatgatataaataaagtggctcaaaaagttatggaa
agaaagaatcgcggcaaaagtttcagtattattgttgttgcagaaggtgcaaaagatgtt
gaaggcgatatggtggtcaataaggttgtcgaagacagtcccgatccaattagacttggg
ggagtaggtaataaaattgctgcagaaatagaaagaattaccggaattgaatctagagtc
acagtattgggacacctgcaaagaggcgggacaccggtgccttacgacagaatactatcg
accaggtatggcgttcacgctgtggaactgattaatcagggaaaattcggtatgatggta
agtctaaagggaaacagaattacagaggtaccgatagaggaggctgttggcactttgaag
acagtggatcccgatggagaactggtaaaaatagcgaaaagccttggggtgggttttggc
gattaa

DBGET integrated database retrieval system