KEGG   Clostridium clariflavum DSM 19732: Clocl_1225Help
Entry
Clocl_1225        CDS       T01661                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410020..1410628
Genome map
AA seq 202 aa AA seqDB search
MFAYIRGKLEYKHNDYIVVEANGVGYKIYTSLSTIQNIQPVGNEVKIYTYLYVREDVMNL
YGFLTQEELGMFELLLGVSGVGPKAAISVISSMSPSKFGLSVITNDYKSLTKAQGIGSKM
AQRIVLELKDKINKTELVSSFGEKDQAADEIKDNSRFSEAVSALIVLGYTASEANKAVAS
VYREDMDIESVIKNALKTLVRN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgcctatatacgaggaaagcttgagtacaagcataacgattatattgtggttgaa
gctaatggagtaggatataaaatatatacatctttgtcaaccattcaaaatatacaacca
gttggaaatgaagtgaagatatatacctatctttatgtacgtgaagatgtaatgaacctg
tacggctttttaacacaagaagaattgggaatgtttgagttgcttttgggggtctccgga
gtagggcctaaagcggctatatcggttatttcatccatgtcaccgtcaaaattcgggctt
tctgtaataaccaacgattataagtcgcttaccaaagctcagggtattggcagcaaaatg
gcacagagaatagttctggaacttaaggataagataaataaaacagagctggtaagcagt
ttcggtgaaaaagatcaagctgccgatgaaattaaagacaattcaagattctctgaggcg
gtaagtgcactgattgttttgggatataccgcatctgaggcaaacaaggctgtagcatct
gtatatagagaagatatggatatagaatcggttataaaaaatgctcttaaaactcttgta
agaaattaa

DBGET integrated database retrieval system