KEGG   Clostridium clariflavum DSM 19732: Clocl_1681Help
Entry
Clocl_1681        CDS       T01661                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920074..1921093
Genome map
AA seq 339 aa AA seqDB search
MEYLNVLKDLSMYVGVSGREKEISQYIEGLFKNYCDEVRIDEFYNVCGYKKGSGDTGKKI
MIMAHHDEIGMLVKSIDDRGFVKFTNIGGIDTKILLAQEVIIHGSEDIYGVIGAKPPHLL
KPEDTKKAVKMEDLYIDTGLSKENISKLVSIGDVITFKTYLFELKGNKLSSKCLDNRAGV
AALLDIMERLSKLSHNDDVIFVATSQEELGLSGAKIASYNINPDMAIVIDACHGEIPDAS
KDETYALGKGPAIAIGPNIHRAYTNKIIEVAKEENIPYQIDVEPGNTGTEAWATQVSRAG
IPSLLISIPVKYMHTTVETLHINDIKNTGKLVSRFVSGL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttgaacgtattaaaggatcttagcatgtatgttggggtatcaggaagagaa
aaagaaatatcccaatacatagagggactgtttaaaaattattgcgatgaggtaagaata
gacgaattttataacgtatgcggatataaaaaaggatccggtgataccggaaaaaagatt
atgattatggctcatcatgatgaaataggtatgttggttaaaagcattgatgacagggga
tttgtgaaatttaccaacataggcggaatagatactaaaattcttttggcgcaagaggtt
atcattcacggtagtgaggatatttacggagttattggggcaaagcctccgcaccttctt
aaacctgaggatacaaagaaggctgtcaagatggaggatttatatatagataccggactt
tcaaaagagaatatatcaaagctggtttcaataggagatgttataacctttaagacttat
ctttttgaacttaagggaaataaattaagttcaaaatgccttgataacagagccggagtt
gccgctttactggatattatggagaggctgtcaaaactcagccacaatgatgatgtgata
tttgttgctacatcacaggaagagcttggattgagcggtgcaaaaatagcctcctacaat
attaatccggacatggcaattgttatcgatgcctgtcatggagaaattcctgatgcttca
aaagacgaaacctatgctttgggcaaaggacctgccatagcaatagggccgaacattcac
agagcatacaccaataaaataattgaggtggcaaaggaagaaaacataccttatcagatt
gatgtggagccgggaaatacgggaactgaggcttgggcaacccaggtgtcgagggcggga
attccgtcattgctcatttccattccggtaaaatatatgcatactactgtagagacttta
cacataaatgatattaagaatacaggtaaactggtttcaagatttgtttcaggattgtag

DBGET integrated database retrieval system