KEGG   Clostridium clariflavum: Clocl_1682Help
Entry
Clocl_1682        CDS       T01661                                 

Definition
(GenBank) peptidase family protein
Organism
ccl  Clostridium clariflavum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1921190..1922215
Genome map
AA seq 341 aa AA seqDB search
MYLKELTELNGVSGNEDEVREFIKEHIKELADEIKIDSMGNLIAFKKGKSKKLKVMLSAH
MDEVGFMVTGFGDSGVIKFATVGGIDERILPGKRVLVGEKKIPGVIGSKPIHMQEKDERN
ANVKLKKMYIDIGTDKKEETEKLVSLGDYIAFHSPYTEFGDGLVKAKALDDRVGCAILME
ALKERYEFDLYACFTVQEEVGLRGSEVAAYTVNPDIALVVEGTTCSDVPGVEKSEYSTVL
GEGAALTIMDRTSYPDKNFVNYIYELAQRNKLPVQFKQTNTGGNDAGKIQMSRSGVVTAS
ISVPCRYIHSPVSVMSKKDFNSCKDIVIAVLKDLGTREEAY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgtacttaaaagaacttacagaattaaatggggtttcgggaaatgaagacgaagtcagg
gaatttataaaagagcatattaaggaattggccgatgagataaaaattgattcgatggga
aatcttattgcctttaagaaaggcaaaagcaaaaaactcaaggtaatgctttcagcccat
atggatgaagtgggatttatggttacaggttttggcgatagtggtgttataaaatttgcc
actgttggaggtattgatgaaagaatacttcctggcaagagagtattggttggagaaaaa
aagattcctggggtaattggctcaaaacctattcatatgcaagaaaaagatgaacggaat
gctaatgtgaagttaaagaaaatgtatatagatattggcaccgataaaaaggaagaaact
gagaaattggtgtcattgggagattatattgcttttcacagtccctatacagaatttggc
gacgggcttgtaaaggcaaaggctttggacgatagagtgggctgtgcaatacttatggag
gcactgaaagaaagatatgaatttgacttgtatgcctgctttacggttcaggaagaagta
gggctcagaggttctgaagttgctgcctatactgttaatcccgacattgcattggtggtt
gagggtacaacttgttccgatgtacctggagtggaaaagagtgagtattctacagtctta
ggtgaaggggcagcccttacaataatggaccgtacatcgtatcccgacaagaattttgtt
aattatatatatgagttggcacaacgaaacaaattaccggtacaatttaaacaaaccaat
accggaggcaatgatgcgggaaaaattcagatgagcagaagcggagtagtaactgcttct
atatcagtaccttgcaggtacattcattccccggtatcggttatgagcaaaaaggacttt
aacagttgcaaggatatagtaatagcagttttaaaagaccttggaacaagagaagaagct
tattga

DBGET integrated database retrieval system