KEGG   Clostridium clariflavum: Clocl_1683Help
Entry
Clocl_1683        CDS       T01661                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccl  Clostridium clariflavum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocl_1683
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Clocl_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1922275..1923252
Genome map
AA seq 325 aa AA seqDB search
MFELIKRLTQSFGVSGNEEEIRETIINEIKNDIQEIRVDTLGNLIATKPGKGKKIMVAAH
MDEIGVMATYIDEKGFIRFSNIGGVSAFVSLGQKVKFKNGTVGAVFYEDKLEDMKNLKLS
KMYIDIGAKDKKEAEKLVRIGDVACFVGDAVRQGDMVISKAIDDRSGCAVLIEAIKRLPQ
TDNEIYFVFTVQEELGLRGAKTAAYQLKPDIAIAVDVTATGDTPEANLMEVKCGGGPAIK
IKDRSVICHPEVKKLLEESARNINIPYQFEVLEYGGSDPGAIHISAGGVPSGAISIPCRY
LHSPVEAASLEDIENAVKLLIEAIK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagttaataaaaaggttgacacaatcttttggtgtttcaggcaatgaagaagaa
ataagggagactatcattaatgaaataaagaatgatatacaggaaataagagtggatact
ttgggtaatcttattgccacaaaaccgggaaaaggcaaaaagattatggtggcagcacat
atggatgaaattggagtgatggcaacttatatcgatgaaaagggatttataaggttttcc
aatattggaggagtttcagcctttgtttctttgggacagaaagtaaagttcaaaaacggt
acagtgggtgcagtattttacgaggataaactggaagatatgaagaatttaaaactgtca
aagatgtatatagatatcggtgcaaaggataaaaaagaggctgaaaaattagttcgcatt
ggcgatgttgcctgctttgtgggagatgctgtaaggcagggagatatggttatatccaaa
gcaattgacgatagaagcggatgtgcagtacttattgaagctataaagcgtctgccccag
acagataatgagatatattttgtatttaccgttcaggaggaattgggacttagaggggca
aaaacagctgcttaccagttgaagcccgatattgcaattgcagtagatgtcactgctaca
ggagatactcccgaggcaaaccttatggaagtaaaatgcggaggcggacctgccataaag
ataaaggacagatcagtaatatgccatcctgaagttaaaaaattattggaagaatcggcc
aggaatataaatataccgtatcagtttgaggtacttgagtatggcggcagtgaccccggt
gcaatccatatttcagcaggaggagttccgtcgggtgcaatttcaattccctgcagatat
cttcacagcccggtggaagctgcaagccttgaagatattgaaaatgcggtaaaattacta
attgaagcaataaaataa

DBGET integrated database retrieval system