KEGG   Clostridium clariflavum DSM 19732: Clocl_1786Help
Entry
Clocl_1786        CDS       T01661                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ccl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045568..2047070
Genome map
AA seq 500 aa AA seqDB search
MGQGFVALVGAGPGELGLLTLKAKECIEKADVVVYDRLVSSEILDLIPSGAKKIDAGKDA
GNHKITQENINQILLTEAQKGNFVVRLKGGDPFLFGRGAEELELLAESNIPFEVVPGVTS
ALSVPAYAGIPVTHRDFSSSVHIITGHRKKDEKLKINYKALSQLEGTLVFLMGVANLKEI
MDGLIEANMDSLTPVAVIENGTYPNQRTVVGTIENIYEKATRCNIKPPAVIVVGKVCNLS
VKYDWFRKRPLFGKKIIVTRPKISGNTLCTKLRNLGAEVYEYPCIEIEEIFDNELLKNEI
DHISDYSWLVFTSKNGVKIFFDFIKREAKDFRILSGIKIAAIGSQTAQALKDNGIISDFV
PDIFDGEHLAKGIAERVGNGDKVLLLRAMKGTEEIPKILEGRGIFYKDIPLYDTLLKNEN
AKYFENLINHNEIDFVTFTSSSTVEGFVKSMPKADLSKITGICIGNKTAQTAKHYGIKHV
ISQQATIDSMIAKILEVCNE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggggcaggggtttgtagcattagttggagcagggcctggagaactcggccttttaacc
ctgaaggctaaagaatgtatagaaaaagccgatgtggttgtttatgatcggctggtatct
tcggaaatactggatttaattccatcgggtgcaaaaaaaattgatgcgggcaaagatgcc
ggaaaccacaaaattactcaggagaatattaatcaaatccttcttaccgaggcacagaaa
ggtaattttgtagtaaggttaaagggcggcgatccctttttattcggtagaggtgcagaa
gagctggagcttcttgcagaaagcaatattccttttgaagtggtaccgggagtgacttct
gccttatcggttccggcttatgccggcattccggttacccatagggattttagcagtagt
gttcacattatcaccgggcatagaaaaaaggatgaaaaattaaaaataaattataaagct
ctttcccaactggaaggcactttggtatttttaatgggcgtagcaaacttaaaggaaata
atggatggccttattgaagcaaatatggatagtctgacaccggtagctgttatagaaaac
gggacatatccaaatcaacgcactgttgtagggacaattgaaaatatttatgaaaaagcc
actagatgcaatataaaacctcctgcagtaattgtagtgggtaaggtatgtaatctatca
gttaaatatgattggttcagaaaaaggcctctatttgggaaaaagatcatagtgacaaga
ccaaaaatttcaggtaacactttatgtacaaagcttagaaatcttggggccgaagtttat
gaatacccttgcatagaaattgaggagattttcgacaatgaacttttaaaaaatgaaata
gatcatatctccgattatagctggttggtgtttacaagcaaaaacggagtaaaaatattt
tttgatttcataaaaagggaagcaaaagatttccgaatacttagcggcattaaaattgct
gccataggctctcaaacggcacaggcacttaaggataatggcataatttccgatttcgtg
ccggatatctttgatggagaacacctggccaaaggtattgccgaaagagtaggtaatggt
gataaagttttgcttttaagagcaatgaagggaacggaagaaataccaaaaatattggag
ggaagagggattttttataaagatattcccctgtacgacacattattaaaaaatgaaaat
gctaaatactttgagaatttaatcaatcataatgaaatagattttgtgactttcaccagt
tcgtcaacggttgagggatttgtcaaatcaatgccgaaggcggatttgtcaaaaataacg
ggcatttgtataggcaataaaacagcccaaacggcaaagcactatggaataaagcatgtg
atttctcaacaagccacaatagatagcatgattgctaaaattttggaggtatgcaatgaa
tag

DBGET integrated database retrieval system