KEGG   Clostridium clariflavum: Clocl_1838Help
Entry
Clocl_1838        CDS       T01661                                 

Definition
cysteine desulfurase NifS
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
ccl  Clostridium clariflavum
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Clocl_1838
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Clocl_1838
Enzymes [BR:ccl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Clocl_1838
Transfer RNA biogenesis [BR:ccl03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Clocl_1838
 Prokaryotic Type
    Clocl_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2114888..2116069)
Genome map
AA seq 393 aa AA seqDB search
MDNRIIYLDHAATTPVKPEVLEEMLPYFTNKFGNASSIYSIGRESKKAIEEARERVAKAL
GAMPREIFFTGSGSEADNWAIKGVAYANKAKGNHIITTAIEHHAVLHTCQYLESDGFEVT
YLPVDENGLVSPEQVRKAIKPSTTLITIMFANNEIGTIQPIAEIGKIAKEHNIYFHTDAV
QAVGNIPINVNELNVDLLSLSAHKFYGPKGVGALYIRKGVKITNFLHGGAQERGRRASTE
NVAGIVGLGKAIELATNNIEQYNKKLIELRDRTIEEITKKVPFVKLNGDRYKRLPGNVNF
SFQFIEGESLLLMLDMKGIAASSGSACTSGSLDPSHVLLAIGLDHETAHGSLRITFGEEN
THEDVDYLMEVLPAIVQRLREMSPLYEKVKRGN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataacaggataatatatttggatcatgcagcaacaacacctgtaaaacctgaggtt
cttgaagaaatgttgccttattttacaaataaattcggtaatgcctcatcgatatacagt
atcggaagagaaagcaagaaagcaatagaagaggcaagggaaagagttgcaaaagctttg
ggtgctatgccaagggagatattctttacaggttccggttctgaagcagataactgggca
atcaaaggagtggcttatgccaataaagcaaaagggaatcacataattactactgccata
gaacatcatgctgtgcttcacacttgccaataccttgaaagcgacggctttgaagttacc
tatcttccggtggatgaaaacggattggtatcaccggaacaggtaagaaaagcaattaag
ccctctaccaccttgataacaataatgtttgccaataatgagatcggtaccattcagcca
atagctgagatcgggaaaattgcaaaagagcataatatttattttcacaccgatgcagta
caggctgtcggcaacataccgataaatgttaatgaattgaatgtagacttattatcgcta
tcagctcataaattctatggacctaaaggtgtaggggcattgtatataagaaaaggcgta
aaaattacaaatttccttcatggcggagcacaggaaagaggaagaagggccagtacagaa
aatgtagccggaatagtgggccttggtaaagcgattgagcttgcaacaaataatattgag
cagtataataagaaattgattgaattaagggacaggactattgaagaaattactaaaaaa
gtaccttttgtaaaattaaacggtgacaggtataaaaggttaccgggaaatgttaatttt
tcgttccagtttattgagggtgagtcgcttttattgatgcttgatatgaaaggtatcgca
gcatccagcggttccgcatgtacttcaggttcattagatccgtcccatgttctgttggct
attggacttgaccatgaaacagcccatggttcactaagaataactttcggagaagaaaat
acccacgaggatgtggattatctgatggaagtacttcctgcgatagttcagaggttgagg
gaaatgtctccattatatgaaaaagtgaaaagagggaattga

DBGET integrated database retrieval system