KEGG   Clostridium clariflavum DSM 19732: Clocl_1942Help
Entry
Clocl_1942        CDS       T01661                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ccl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2234475..2235548)
Genome map
AA seq 357 aa AA seqDB search
MENKCNKKIRVLVVDDSAFMRKVISDILESDSSIELVGTAKSGIDALEKVRKLKPDVVTL
DIKMPGMDGLECLEELNKVGNVPVVMLSSITQDAAEATIQALEKGAIDFITKPSNIFDIN
SKEKKQEIIEKVKIASKSVPYLKINTRVKNKEPLYKESTTLNNIVLIGTSTGGPKALQEV
IPAIPEDVNAAFLVVQHMPPGFTKSLAERLDGMSKVRVKEAENDELIKTGYVYIAPGDYH
MLAERDEKSKLKIKLTKDPRVGSHRPSVDVLLESVSNTGFENVVAVIMTGMGGDGSEGIK
KLKENKNVSVIAQDEKTCVVFGMPKAAIQTGVVDIVTPLSEISNEIMKIVGVQKQWT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaataaatgcaacaaaaaaataagagtactggtggttgatgattcagcattcatg
agaaaagttatatcggatattcttgaaagtgacagcagcatagaactggtaggtactgca
aaaagcggaattgacgctcttgaaaaggtaagaaagcttaagcccgatgttgttacttta
gatataaaaatgcccggaatggacgggcttgagtgcttagaggaactcaacaaagtggga
aacgtacctgttgtaatgttgagcagtattacacaagatgctgctgaagcgacaattcag
gctcttgaaaaaggagcaatagattttataaccaagccttcaaatatattcgatataaat
tctaaagaaaagaagcaagagattattgagaaggtgaaaatagccagtaaatctgtacct
tacttaaaaataaacacaagagtaaaaaataaagagcctttatataaggaaagcacgaca
cttaacaatatagttttgattggaacttcaacaggcggtccaaaagctcttcaagaggta
attccagccatacctgaagatgttaatgcagcattcctggttgttcagcacatgccgccg
ggttttacaaaatctttagccgaaaggcttgacgggatgagtaaagtacgcgtaaaggaa
gcagaaaatgacgaactgataaaaacaggatatgtatatattgcacctggagattaccat
atgcttgctgaaagggatgaaaaatcgaaattgaaaattaagttgacaaaagatccccgt
gtaggaagtcacaggccatcagtggacgtactgcttgaatcagtttcgaatacaggcttt
gagaatgttgttgcggttataatgactggaatgggtggagatggaagtgaaggaattaaa
aaattaaaggaaaacaaaaatgtcagtgtaattgctcaagacgagaaaacatgtgtagtt
ttcggtatgccaaaagcggcgatacaaacgggagttgtagatatcgttacacctcttagc
gaaatctccaacgaaattatgaaaatagtgggggtgcaaaaacaatggacatga

DBGET integrated database retrieval system