KEGG   Clostridium clariflavum DSM 19732: Clocl_2441Help
Entry
Clocl_2441        CDS       T01661                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccl  Clostridium clariflavum DSM 19732
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801372..2803759)
Genome map
AA seq 795 aa AA seqDB search
MTKKLKAFFSTLMCCTFLFTLLPANVQAMTLTNNATGTYQGYDYEYWKDRGNGTMTLTGG
GTFTCSWNNINNILFRTGKKLGSQKTYQEYGNIYIEYACDYRPNGNSYLSVYGWTQGPLV
EYYIIESYGTWKPPGSNQVKGYVNADGGTYEIYQTTRYNAPSIEGDKTFDQYWSVRTQKR
TSGTISVHEHFKQWEARGMRMGRLYEVSMVVEGYQSSGQANMTKMDLIIGGQPSTTSAPA
TSKPVTEKNAFQKIEAEDYDELVGSEARSIGMGIGYINNGDYAAYKSVNFGNGASSFKAY
VANGNNSNTTIQLRLGGPNGTLIGSLSVPYTGGWDTYEEMTANVSGASGTKDLYLCFSGP
VNVDWFSFGTGSPVPTNSGNPGSRKYGDLDLDGQVTAIDLATFKSHLLGMSTLTGEALAN
ADVSGDGDVNSIDMAIIKQYLLGMISKFPAENNTPPSTPTPVKTPPPSPQGTALYQLAAA
KGKYFGACINSPWFNNQTNSTYNNILRTEFGMVVAENEMKFDALEPSQNNFNWSKADKMM
DFARSNNMKVRGHTLVWHSQNPGWVTSGRWNRDSLISVMNNHINKVLGRYKGQILEWDVV
NEVIDDGNGWGLRNNSVWKSNIGNDFVEIAFRTARQADPDALLYYNDYNIEDLGGKANAA
YNLVKSLKEKGVPIDGIGFQSHFISGMSDQTFRDIDTNVKRYAALGVKVSFTEIDIRIPD
NANQYQAFQTQANEYRKLMEICLNNDNVTTFVLWGFTDQHTWVPQVFPGYGRPLIYDNNY
NPKPAYNALKEILMQ
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaattaaaggcatttttttcaaccctaatgtgttgtacattcttgttcact
ttgcttccggcaaatgtgcaagcaatgacgcttactaataatgctacaggaacatatcag
ggttatgactatgaatactggaaagatagaggtaatggaacaatgactcttacaggagga
ggtacttttacttgttcctggaacaacattaacaacattctgttccgtaccggtaaaaaa
ctcggatcacaaaaaacatatcaggaatacggaaatatatacatagaatatgcttgtgac
tacagaccaaatggtaactcatatctttccgtttatggatggacccagggtcctcttgta
gagtattatatcattgagagctatggtacctggaagccaccaggaagcaatcaggtaaaa
ggttatgttaacgctgacggcggtacatacgaaatttatcaaacaaccagatacaatgct
ccatccattgaaggagacaaaactttcgatcagtattggagtgttcgtacacagaaacgt
acaagcggaaccatatctgttcacgagcactttaagcaatgggaagccagaggcatgaga
atgggtaggctttatgaagtttccatggttgttgaaggatatcagagtagcggtcaagct
aacatgacaaaaatggaccttattattggcggacaaccatctacaacttcagcgccagca
acttctaaaccagtaactgaaaaaaatgctttccaaaaaattgaagcagaagactatgat
gagttggttggttctgaagcaagatccattggtatgggtataggatatataaacaatggt
gactatgctgcatataagagtgtgaattttggaaacggtgcaagttctttcaaagcatat
gttgcaaacggtaataatagcaacacaactattcaattaagattaggtggtccaaacgga
actcttatcggttcattgtccgtaccgtatactggcggttgggatacatacgaagaaatg
actgctaatgttagcggtgcttcgggtaccaaagacttgtatctctgcttcagcggaccg
gtaaacgttgactggttctcatttggcaccggcagccctgttcctactaattctggaaat
cctggttcaaggaaatatggtgatttagaccttgatggacaagttactgctatagacctt
gcaacatttaaatcacatttactcggtatgtcaactcttactggtgaagcattggcaaat
gctgatgttagcggagacggtgatgtaaactcaatagatatggcaattattaagcaatat
ttgttgggtatgatatcaaaattccctgcagaaaataatacacctccttcaacaccaact
cctgttaagactccacctccatcaccgcaaggtacagcattgtatcaattagctgcagca
aaaggtaaatattttggtgcatgtataaacagtccttggtttaacaaccaaactaatagc
acatacaataacattctcagaacagagttcggtatggttgttgctgaaaacgaaatgaag
ttcgatgctttagagccatctcagaataacttcaactggtcaaaagctgataaaatgatg
gattttgctagaagcaacaatatgaaagtacgtggacatacacttgtatggcatagccag
aacccaggttgggttacaagcggaagatggaaccgtgattcattgatttcagttatgaac
aaccatattaataaagttttgggacgttataaaggacaaatcttagaatgggacgttgtt
aatgaggttatagacgatggaaacggttggggactcagaaacaacagtgtttggaagagc
aatatcggtaacgatttcgtagaaatagcattcagaactgcaagacaggctgacccagat
gcacttctctattataacgattataatattgaagacttgggtggaaaagctaacgctgct
tacaatttggttaagagcttgaaagaaaaaggagtacctatcgatggtataggattccag
agccactttatcagcggaatgagcgaccaaacatttagagacatagacacaaatgttaag
agatatgcagctttaggagtaaaggtatcctttactgaaatagatataagaatacctgat
aatgcaaatcaatatcaggcattccagacacaggcaaacgaatataggaagttaatggaa
atttgcctcaataatgacaacgttactacattcgtattgtggggattcactgaccagcat
acttgggttccacaagtattccctggttacggaagaccattgatttatgacaacaactac
aatccaaaaccagcttacaacgcattgaaagaaatattaatgcagtaa

DBGET integrated database retrieval system