KEGG   Clostridium clariflavum: Clocl_2476Help
Entry
Clocl_2476        CDS       T01661                                 

Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccl  Clostridium clariflavum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Clocl_2476
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Clocl_2476
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clocl_2476
Enzymes [BR:ccl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Clocl_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2841996..2842718)
Genome map
AA seq 240 aa AA seqDB search
MKLICYLSNGYPTIESSINIAKEYVEAGCDIIEVDFPSSNPFLEGEYIAGRMKTALENCS
DYSCYMEGIKTIKNNHPNTKFIVLSYENTIESIGVERFIEFCTQNGLYDMIYVGGDNQEI
KSKLIENGIKISCYVQFHMPEEEIQAALSSNGFVYMQAKPTTNNINPKYPTLKDCIDELK
RRGITREIYAGVGIYTTEDIQMAKEAGADGVFVGSTILKLQTDIPKMKETIEKFKKACNE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatatgctacttgtctaacggatacccgacaattgaatccagcattaacatt
gctaaagagtacgtagaggctggctgtgatataattgaagtggattttccgtcatccaat
ccgttccttgaaggtgaatacattgcaggaagaatgaaaactgctttagagaactgtagt
gattacagttgttatatggaaggcataaaaactataaaaaataatcatccaaacactaaa
tttattgtactttcttatgaaaataccattgagagtataggtgttgaacggttcattgaa
ttttgtactcaaaatggcctatatgatatgatttatgtgggtggagacaatcaagaaata
aaaagtaagttaattgaaaacggaataaaaatttcatgctatgtacagtttcatatgccg
gaagaagaaatacaagcagcactttcctccaacggatttgtttatatgcaagcaaagcct
accaccaataatataaatcccaaatatccaactctaaaggactgcatagatgagctgaaa
agaagaggtattacgagagaaatctatgccggtgtgggaatttacacaaccgaagatatt
cagatggcaaaggaagctggagcagatggtgtttttgtgggtagtaccatcttgaagctt
cagacagatattccgaagatgaaagagaccattgaaaaatttaaaaaggcctgtaatgaa
tag

DBGET integrated database retrieval system