KEGG   Clostridium clariflavum: Clocl_2592Help
Entry
Clocl_2592        CDS       T01661                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00010  Glycolysis / Gluconeogenesis
ccl00620  Pyruvate metabolism
ccl00640  Propanoate metabolism
ccl00680  Methane metabolism
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01120  Microbial metabolism in diverse environments
ccl01130  Biosynthesis of antibiotics
ccl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_2592
   00620 Pyruvate metabolism
    Clocl_2592
   00640 Propanoate metabolism
    Clocl_2592
  Energy metabolism
   00680 Methane metabolism
    Clocl_2592
Enzymes [BR:ccl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Clocl_2592
Lipid biosynthesis proteins [BR:ccl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Clocl_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEV69160
UniProt: G8M1E5
Position
2985713..2987365
Genome map
AA seq 550 aa AA seqDB search
MLEKYLSRIDFDSYEDFVENFKINVPDNFNFAYDVVDEIAAKSPDKLAIVWCDEKGNEAT
FTFGQLKYYSDKAANFFTKVGIGKGDPVMLILKRRYEFWFAILALHKIGAICIPATHLLT
AKDIIYRNNAADIKMIVCVGEDEVIKHVEESMSQSPTLKAVALVGGSKEGWYDFNKEVEE
ASPEFARPTGDKATTNDDIMLLYFTSGTTGMPKMVRHNFTYPLGHIITAKYWQNVEDGGL
HLTVADTGWAKAVWGKIYGQWLAGAAVFVYDYDKFVPKDLLNIISKYGITTFCAPPTIYR
FFIKEDLSKFDLSKLKYCVVAGEPLNPEVYNQFYKATGIKLMEGYGQTELTVVLGTFPWM
EPKPGSMGKPSPEYEVDIVDENGKSCEIGEEGQIVIRTGKNIPVGMFGGYYRDEALTKKV
WHDDVYYTGDMAWKDEDGYFWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITAV
PDPIRGQIVKATVVLTKNYTPSDALVKELQDHVKKVTAPYKYPRIVEFVDELPKTISGKI
RRVEIRERDA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaaatatctttcccgtatagattttgattcctatgaggattttgttgaaaat
ttcaaaataaacgtaccggacaatttcaattttgcctatgatgttgtggatgaaattgct
gctaaaagtcccgacaagctagcaatagtatggtgcgacgaaaaaggtaatgaagctacc
tttactttcgggcagttaaaatactacagtgataaggcagcaaactttttcactaaagtc
ggtatcggcaaaggcgatccggtaatgctgattctgaaaaggcgctatgagttctggttt
gctatattagcgctccataagatcggtgcaatatgtattcctgcaactcatcttctgact
gcaaaagatattatttatagaaataatgcggccgatataaaaatgattgtttgtgtaggt
gaagatgaagttataaaacatgttgaagaatccatgtcccaatctcctaccctcaaggcc
gtcgcgcttgtaggcggttcaaaggaaggctggtatgatttcaataaagaagttgaagaa
gcttctcctgagtttgcaagacctacaggagacaaggcaactaccaacgatgatataatg
cttttatacttcacatcgggtactaccggtatgccgaaaatggtaagacataattttaca
tatccattaggtcacattataactgcaaaatactggcaaaatgttgaagatggaggttta
cacctcaccgttgcagacacaggctgggcaaaagcagtatggggtaaaatatacggacaa
tggctggccggagctgcggtttttgtttatgactatgacaaatttgtacccaaagatctc
ttaaatattatctccaaatacggtattacaactttctgcgcacctcctaccatatatcga
ttctttatcaaggaagacttatctaaatttgacttaagtaaattgaaatattgtgttgta
gccggggaaccgttaaatcccgaggtgtacaaccagttttataaagcaacaggcattaaa
ttaatggaaggttacggtcaaaccgagcttaccgttgtattgggtacattcccatggatg
gaacccaaaccgggttcaatgggtaaaccatctcccgaatacgaagttgatatagtggac
gaaaacggaaaatcttgtgagattggtgaagagggacagatagtaataaggaccggaaag
aacataccagtaggtatgtttggaggatattacagagatgaagctctgactaaaaaagtt
tggcatgacgatgtttactataccggagatatggcctggaaagatgaagacggttacttc
tggtttgtgggaagagccgatgatgtaattaagagttccggttacagaataggacctttt
gaagttgaaagcgcccttttggaacatccagctgtattggaatgtgctataacagcagta
ccggatccaatcagaggtcagattgtaaaagcaacggttgtacttaccaaaaactatact
cccagtgatgcactggtaaaagagcttcaggaccatgtaaaaaaagtaaccgctccttat
aaatatccaagaatcgttgaatttgtggacgagcttccaaaaaccatcagcggaaaaatc
cgcagagttgaaatacgtgaaagggatgcctaa

DBGET integrated database retrieval system