KEGG   Clostridium clariflavum: Clocl_2639Help
Entry
Clocl_2639        CDS       T01661                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ccl  Clostridium clariflavum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clocl_2639
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clocl_2639
   00600 Sphingolipid metabolism
    Clocl_2639
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clocl_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3051733..3053055)
Genome map
AA seq 440 aa AA seqDB search
MVKIAFLGAGSTVFARNVLGDCMCTPCLKDAEIALYDIDPKRLEESEIILKAINKNVNSS
RAKIYTYLGEKQRKDALRDSDFVINAIQVGGYDPCTIIDFEIPKKYGLRQTIGDTLGIGG
IMRGLRTIPVMRDIARDMEEVCPKALFLNYTNPMSILTGYMQRYTKIRTVGLCHSVQICS
YYLLKDLGMEDKLDGRSDFIAGINHMAWLLDIRDKEGKDLYPEIRRRALLKNSNEKHNDM
VRYEYIKYFGYYCTESSEHNAEYNPFFIKSKYPELIEKYNIPLDEYPRRCISQIEGWENE
KNNILRDGKITHERTNEYASYIMEAIITNKPFKIGGNVLNTGLIENLPYDACVEVPCLVD
GNGISPCHVGKLPVQLAAMNMTNINVHLLTIEAACTKRREAIYQAAILDPHTAAELSIDD
IVKMCDEMILAHGEYMKEYR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaatagcgtttttaggtgctgggagtacggtgtttgcaagaaatgtgcttggt
gactgtatgtgtacgccatgtcttaaagatgcagaaattgccctatatgatatagaccct
aagcgacttgaggagtcggaaattattctcaaggctatcaacaaaaacgttaattcctcc
agagccaagatttatacatatttaggtgaaaaacaaagaaaagatgctttaagagattcg
gattttgtaatcaatgcaattcaggttggcggatatgatccctgtactattatagacttt
gaaattccaaagaaatacggtttgagacagaccataggcgatactttgggaatcggggga
attatgcgcggccttagaacaatccctgttatgagagatattgcaagagatatggaagag
gtttgtcccaaggctctttttcttaactacactaatcccatgtccatcttgaccggttat
atgcaaaggtatacaaaaatacgtaccgtcggtttatgccacagcgttcaaatctgttca
tactatctgcttaaagaccttggtatggaggacaaactggatggacgcagtgattttatt
gccggtattaatcatatggcatggctcttagatataagggataaagagggaaaagattta
tatcctgagattagaagacgtgccctcttaaagaacagcaacgaaaagcataatgatatg
gttcgatatgaatacatcaagtatttcggttattactgcaccgaatccagtgagcataat
gccgaatacaatccgttttttataaaatcaaagtacccggaattaattgaaaaatacaat
attccgttagatgagtatcccagaagatgtatcagccagattgaaggatgggagaacgag
aaaaacaatattctgcgggatgggaaaataacccatgaaagaaccaatgaatatgcatca
tatattatggaagccataattaccaataagccttttaaaattggcggaaatgttttaaat
accggattgattgaaaatctgccctatgatgcttgtgttgaagttccctgtctggtagac
ggcaatgggatttcgccgtgccatgtaggaaagttacccgttcaactggcggccatgaat
atgacaaatataaatgttcatctgctgaccatagaagcagcttgtacaaagagaagggag
gctatatatcaggcagctattttggatcctcatacggcagctgaattgtccattgatgat
attgttaaaatgtgtgatgagatgattttagctcatggtgaatatatgaaagaatacaga
tga

DBGET integrated database retrieval system