KEGG   Clostridium clariflavum: Clocl_2719Help
Entry
Clocl_2719        CDS       T01661                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocl_2719
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_2719
   00020 Citrate cycle (TCA cycle)
    Clocl_2719
   00620 Pyruvate metabolism
    Clocl_2719
   00640 Propanoate metabolism
    Clocl_2719
   00650 Butanoate metabolism
    Clocl_2719
  Energy metabolism
   00680 Methane metabolism
    Clocl_2719
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clocl_2719
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clocl_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3161987..3162895)
Genome map
AA seq 302 aa AA seqDB search
MSNGTATINARNITDKEFFYGHKACAGCGGSLAVRLILKVLGERTFTVIPAGCMSAVGFI
YPQMCFLNNAIISTFPGTASMLSGIAAAAKALGLKDYHVVGIAGDGGTADIGLQALSGAI
DRRDRIIYICYDNEAYMNTGIQKSGLTPFGARTTTTPAGDNIPGTVTQKKNMFEIVAAHG
IDYAATASIGYIQDFINKVQKASRVEGTSYIHVFAPCPTGWGIPEDSTIDIAKEVVDCGL
WYLAEFEQGEFILNKNPKEFSPVEEYLKKQSRFKHLSCEDINTIISSRDKKWEKIRKAWK
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatggtactgcaactattaatgccaggaatattaccgacaaggagtttttctac
ggccacaaggcatgtgcaggctgtggcggaagccttgcggtaaggcttatattaaaggtg
ctgggggaaaggacttttacagtaattccggcaggctgtatgtctgctgtgggatttatc
tatcctcaaatgtgttttttaaacaatgccattatttccacattccccggaacggcttcc
atgctttcgggaattgcagcggcagcaaaggcattgggattaaaagattatcatgttgtt
ggtattgccggtgacggaggtactgccgatattggccttcaggcactatccggtgcgata
gaccgcagggataggataatatacatttgctatgacaatgaggcctatatgaacaccgga
attcaaaagagcggccttacacctttcggtgcaaggacaacaactactccggcgggggat
aatattcccggaacagttacacagaaaaagaacatgtttgaaattgttgcagcccatggt
attgattatgctgcaacagcgagtatcgggtatatacaggattttataaacaaagtccag
aaagcgtccagagttgagggaacctcttacattcatgtatttgccccgtgtccgacagga
tggggaataccggaagacagtaccatcgatattgcaaaagaagtggtggattgcggactt
tggtatcttgcagaatttgagcagggagagtttattttaaacaaaaatccgaaagagttt
tcgccggtagaggaatatttaaagaaacagtcaaggtttaagcatttgagctgtgaagat
attaatacaataatatcttcaagggataagaagtgggagaaaataagaaaagcgtggaaa
attaaataa

DBGET integrated database retrieval system