KEGG   Clostridium clariflavum: Clocl_2721Help
Entry
Clocl_2721        CDS       T01661                                 

Definition
2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
Organism
ccl  Clostridium clariflavum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3164065..3164376)
Genome map
AA seq 103 aa AA seqDB search
MNRPLLRKYEKPKHINDYPVGPCFEAGYLVTENSGWRTKKPVVVKDLCIGCFYCYMCCPE
GVILRKEKLIDIDYAFCKGCGICAKVCPKKAINMEREGGKDGI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggccgctattgagaaaatacgaaaaaccaaaacatatcaatgactatcccgtt
ggaccttgctttgaggcgggatatctcgtaacagaaaattccggctggaggacgaagaaa
cctgttgtagtcaaggacctatgcataggctgcttttattgttatatgtgctgtcctgag
ggtgtgattttacgaaaagaaaagcttatagatattgattacgcattttgcaaaggctgc
ggcatttgtgccaaagtctgtcccaaaaaggctataaatatggaaagggaggggggtaag
gatgggatataa

DBGET integrated database retrieval system