KEGG   Clostridium clariflavum: Clocl_2722Help
Entry
Clocl_2722        CDS       T01661                                 

Definition
2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocl_2722
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_2722
   00020 Citrate cycle (TCA cycle)
    Clocl_2722
   00620 Pyruvate metabolism
    Clocl_2722
   00640 Propanoate metabolism
    Clocl_2722
   00650 Butanoate metabolism
    Clocl_2722
  Energy metabolism
   00680 Methane metabolism
    Clocl_2722
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Clocl_2722
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Clocl_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3164373..3164918)
Genome map
AA seq 181 aa AA seqDB search
MIEIRWHGRGGQGSFTASKLLGASAALYGGKYALAFPSFGPERRGAPVLAFTKIDDKKIN
DRSEIKKCDYIVVLDETLFHESFFNDLKDNGSIIVNSADSKAYSSYDKTKIKTVDATSIA
LEILGKPITNTAMLGALLAVSDIVRLDALKKGMESFMKGSLLEKNIEVVERIFFRMKGES
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatcagatggcatggccggggaggccagggcagtttcacagcttcaaagctt
ctcggtgcatcggcggccctatatggcggaaaatatgcccttgcttttccttcctttgga
cctgagagaagaggggcaccggtcctggcttttacaaaaatagatgacaaaaagataaat
gaccgcagcgaaattaaaaagtgcgattatattgtggttttagatgagactcttttccat
gaaagttttttcaatgacttaaaggacaatggaagtattattgtaaattctgcagacagt
aaagcatattcaagttatgataaaacaaaaatcaaaacagtggatgcaacctccattgcc
ctcgaaattctaggaaagccaataaccaatacagcgatgctgggggctcttttagcagta
tcggatattgtcagactggatgctttgaaaaaaggaatggagagctttatgaaaggctca
ttgcttgaaaaaaacattgaagtggttgaaagaattttcttccggatgaaaggagagtcc
ctatga

DBGET integrated database retrieval system