KEGG   Clostridium clariflavum: Clocl_2759Help
Entry
Clocl_2759        CDS       T01661                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ccl  Clostridium clariflavum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Clocl_2759
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Clocl_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3207185..3207793)
Genome map
AA seq 202 aa AA seqDB search
MFREGLLVVVSGPSGTGKGTVLSCIRQKENRIKFSVSATTREPRSGEVDGVNYFFKTTEE
FEAMIENGELIEWVKYCDNYYGTPKKYVADTIKSGYDCLLEIEVEGALNIKKIYPDCVSI
FILPPSFEELRRRIESRGTEKPEVIEKRMEKALKEMNYVDRYDYVVVNDDIEKAVDSIRY
ILASEKLKFSRNRDILKTIGIS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtgagggactattagttgttgtgtcaggaccgtcgggcaccggcaagggaact
gttcttagctgcataaggcagaaagagaacaggattaagttttcagtttctgcaactacc
agagagcccagaagcggtgaagtggatggggttaattacttctttaaaactaccgaagag
tttgaagcaatgatagagaatggagaacttatagagtgggttaagtattgtgacaattat
tacggtacacctaaaaagtatgttgcggatactataaaatcagggtatgattgtctgttg
gaaattgaagttgagggtgctttgaatatcaagaagatataccctgattgtgtatctata
tttattttgcctccatccttcgaagaattgagaagaaggatagagagcagagggactgaa
aaacctgaagttatagagaaaagaatggaaaaagctttaaaagaaatgaactatgttgac
agatatgattatgttgttgtaaacgatgatattgaaaaggcagttgacagtattcgctac
atacttgcttcggagaaacttaagttcagcagaaacagagatatacttaaaacaatcgga
atatcttga

DBGET integrated database retrieval system