KEGG   Clostridium clariflavum DSM 19732: Clocl_2759Help
Entry
Clocl_2759        CDS       T01661                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ccl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3207185..3207793)
Genome map
AA seq 202 aa AA seqDB search
MFREGLLVVVSGPSGTGKGTVLSCIRQKENRIKFSVSATTREPRSGEVDGVNYFFKTTEE
FEAMIENGELIEWVKYCDNYYGTPKKYVADTIKSGYDCLLEIEVEGALNIKKIYPDCVSI
FILPPSFEELRRRIESRGTEKPEVIEKRMEKALKEMNYVDRYDYVVVNDDIEKAVDSIRY
ILASEKLKFSRNRDILKTIGIS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtgagggactattagttgttgtgtcaggaccgtcgggcaccggcaagggaact
gttcttagctgcataaggcagaaagagaacaggattaagttttcagtttctgcaactacc
agagagcccagaagcggtgaagtggatggggttaattacttctttaaaactaccgaagag
tttgaagcaatgatagagaatggagaacttatagagtgggttaagtattgtgacaattat
tacggtacacctaaaaagtatgttgcggatactataaaatcagggtatgattgtctgttg
gaaattgaagttgagggtgctttgaatatcaagaagatataccctgattgtgtatctata
tttattttgcctccatccttcgaagaattgagaagaaggatagagagcagagggactgaa
aaacctgaagttatagagaaaagaatggaaaaagctttaaaagaaatgaactatgttgac
agatatgattatgttgttgtaaacgatgatattgaaaaggcagttgacagtattcgctac
atacttgcttcggagaaacttaagttcagcagaaacagagatatacttaaaacaatcgga
atatcttga

DBGET integrated database retrieval system