KEGG   Clostridium clariflavum DSM 19732: Clocl_3057Help
Entry
Clocl_3057        CDS       T01661                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ccl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ccl00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ccl00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ccl00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3581368..3582330)
Genome map
AA seq 320 aa AA seqDB search
MGKKYICLDIGGTKILGAVLDEKDNIVFRVKKKTKANKGIEEIEKRIIGVIDELMKELGA
DKKEIEAIAAGAPGVINDETGEIIYAPNLPWENYNLKKVIENEFDIPFYIGNDANLGMLG
EWKYGVAANRENVVGIFVGTGIGGGLILNNKLFTGKRYDAGELGHMVLNTEGPYCNCGQR
GCFEAYASKVAITREIRAQIQRGRKTVLKDFLDEDSIIKSKALKYAIEAEDSVALEVMDN
AIYYLAAGTGNLINIFNPDMVVLGGGVLESLGDYVMPLLKKYLKRFALPALLSGTEIAQS
SLGDDAIIYGALAVIKDKKG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaatatatttgccttgatattggcggtacaaagatacttggagctgttttg
gacgagaaggacaatatagttttccgggttaaaaaaaagaccaaggccaataagggaata
gaagaaattgagaagagaataatcggcgttatcgatgaactgatgaaagagttgggtgct
gataaaaaagaaattgaggcgattgctgcgggtgcaccgggagttataaacgatgaaacc
ggtgaaattatatatgcaccaaatctcccatgggaaaactataatttgaaaaaagttata
gaaaatgagtttgatattccgttctacatagggaatgacgcaaacttgggaatgcttggt
gaatggaaatatggagttgctgcaaatagggaaaatgttgtgggaatatttgtaggcacc
ggaattggcggtgggcttatattaaacaataagctttttacgggtaaaagatatgatgcc
ggtgagttgggacacatggtattaaataccgagggcccttactgtaactgcggtcagcgg
ggatgttttgaggcttatgccagtaaagttgcaataacaagggaaataagggctcaaatt
caaagagggagaaagactgtactgaaagatttcttagatgaagattccattattaaaagc
aaggcgctgaaatatgcaatagaagccgaagacagtgtggctttggaagttatggacaat
gctatatattatcttgcagccggcacaggaaaccttataaatattttcaatcctgacatg
gtggtactgggaggaggcgttttggaatctcttggagattatgtaatgcctctgctgaaa
aaatatctcaaaaggtttgcacttcccgcattgttaagtggaacggaaatagcgcaaagc
agcctgggagatgatgctattatctatggcgctctggccgtaattaaggataaaaaaggg
tag

DBGET integrated database retrieval system