KEGG   Clostridium clariflavum: Clocl_3103Help
Entry
Clocl_3103        CDS       T01661                                 

Definition
CBM6-containing protein,glycosyl hydrolase family 11
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccl  Clostridium clariflavum
Brite
Enzymes [BR:ccl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Clocl_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3636729..3638306
Genome map
AA seq 525 aa AA seqDB search
MKQRSKLIFSTVVCLIFVLSLFPASVNAAITLTSNATGNYDGYDYEYWKDYGNGTMTLTG
GGSFTCSWSNINNILFRTGKKLGSTQTYQQYGNIIIDYACNYQPNGNSYLSVYGWTQNPL
VEYYIIESYGTWKPPGSNSPKGYINVDGGTYEIYETTRYNQPSIEGDKTFQQYWSVRTVK
RTSGTISVHEHFKAWEARGMRMGKLYEVSMVVEGYQSSGRAEMTKMNITIGGQGSGNTGG
NNGGNNGNPGPAPAEQSAFTALEAEKYNSTNSSTVQIIGTGNGGSGVGYIENGNYLEFKN
VNFGSGAASFKARVAYGGNSTTTIQLRLGSSTGTLIGSLNVTSTGGWDSYKELTTTVSGA
SGVKDLYLCFNGPVNIDSFVFGTADNNNDKPVDNKPVDNPGNNNSGPVIIQCENMIKSGQ
YTGNISSPFSGVALYANNDSVKFTHNFTSSTSTFSLRGCSNNQNMARVDLRIGGQYKGTF
YYGGSYPAVYTIQNVSHGTGNQTVELIVTSDNGTWDAYLDYLQIN
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagatcaaagctaattttttcaaccgtcgtgtgcttaatcttcgtactaagt
ttgttccctgccagtgtaaatgcagcaataacgctcacatcaaatgctaccggaaattat
gacggctatgactacgaatactggaaagactacggtaatggaacaatgactctcaccggt
ggcggaagttttacctgttcctggagtaatatcaataatatcttattccgaaccggtaaa
aaactcggatcgactcaaacatatcagcaatacggaaacataataattgattacgcttgt
aattatcagccaaacggaaactcatacctttcggtatacggatggacccaaaatccgctt
gtagaatattacatcattgagagctacggtacctggaagccaccaggaagcaatagtcca
aaaggctacattaatgtagatggcggtacatatgaaatttatgagaccaccagatataat
caaccttccattgagggcgacaaaaccttccagcagtattggagtgttcgtactgtaaaa
cgtacaagcggtaccatatctgtccatgaacactttaaagcttgggaagcaagaggcatg
agaatgggtaaactctatgaagtttccatggttgttgaaggttatcagagcagcggtagg
gctgaaatgacaaaaatgaacattaccatcggcggacaaggctccggtaacaccggcggt
aacaacggcggcaacaacggcaacccaggtccagctccggcagaacaaagcgcctttact
gcattggaagcagaaaaatacaatagcaccaattcctcaacagtgcaaataatcggaacc
ggcaatggcggaagcggtgtaggatacattgaaaacggaaattacctcgaatttaaaaat
gttaacttcggttcaggtgctgcttccttcaaagctcgtgttgcctatggcggcaactcc
accacaaccatccagttaagattgggcagctcgacaggtacacttataggttcattaaat
gtaacttctaccggaggatgggattcttacaaagaattaaccactaccgtcagcggtgca
tccggtgttaaagatctatacctgtgcttcaatggacctgtaaatatagactccttcgta
ttcggtactgccgacaacaataacgacaaacctgttgataataaacctgttgataaccct
ggcaacaataacagcggacctgttattatacaatgtgaaaatatgattaagagcggccaa
tacacaggtaatatcagcagtccgttctcgggtgtagctttatatgccaacaatgattcc
gtcaagtttactcataactttacatcgagcaccagtactttctcacttcgcggttgctca
aataatcaaaacatggccagagtagatttaagaatcggcggacagtataaaggaaccttc
tattatggcggaagttaccctgcagtgtacaccatacaaaacgtgagccatggtaccgga
aatcagacagtagaactcattgtaacaagtgataacggaacttgggatgcttacttagat
tatttacaaatcaattaa

DBGET integrated database retrieval system