KEGG   Clostridium clariflavum: Clocl_3109Help
Entry
Clocl_3109        CDS       T01661                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ccl  Clostridium clariflavum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Clocl_3109
   01230 Biosynthesis of amino acids
    Clocl_3109
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_3109
   00030 Pentose phosphate pathway
    Clocl_3109
   00051 Fructose and mannose metabolism
    Clocl_3109
   00052 Galactose metabolism
    Clocl_3109
  Energy metabolism
   00680 Methane metabolism
    Clocl_3109
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Clocl_3109
Protein phosphatases and associated proteins [BR:ccl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Clocl_3109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3643549..3644790
Genome map
AA seq 413 aa AA seqDB search
MSRLEGACMFGQSGGPTSVINASAAGVIQEALKQECITAVYGAAHGIKGVLEEKFYDMSK
EDPYELELLKTTPSSALGSVRYKLKNADEDETDYKRLLEVFKKYNIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRIMGVPKTIDNDLWGTDHCPGYGSAAKYIATSFMEVYHDARVYDT
GMVTILEVMGRNAGWLTAASALAAYKGNGPDLIYLPEIPFSIEKFLDDVNRVYKANGKVI
VAVSEGCKDEQGRYIAEMGATLAKDSFGHAQLGGAASILANIVKERLGTKVRGIEFSLLQ
RCAAHIASLTDVNEAYMAGQMAVRNAVEGKTDYMVAFERPEGPEYKCNIKLINLTDVANT
EKKIPLEWINKEGNGLTEDFIKYALPLIQGESKPVLEDGLPRFAKLKKVLATK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtttagaaggagcatgtatgttcggccaatccggaggcccaacatcagttatt
aatgcaagtgctgccggagttattcaggaagcattgaaacaagaatgtattacagctgtt
tatggtgcagcacacggaattaaaggtgttttagaagaaaaattctatgatatgagcaag
gaagacccttatgaattggaacttttgaaaactacaccatcatccgctctcggttcagtc
agatacaaactcaaaaatgctgatgaagatgaaacagattacaagagacttctggaagta
ttcaagaaatacaacataaggtatttcttctacaatggcggaaacgactcaatggatact
tgcaacaaagtaagcaagtatatgcagaaagttggttacgagtgtagaattatgggtgtt
ccaaagacaatagataacgatctttggggaacagaccactgtccaggttatggtagtgct
gcaaaatacatagctacttcctttatggaagtttaccacgatgcaagagtttacgatacc
ggaatggtaacaattttggaagtaatgggtagaaatgcaggttggcttacagcagcatcc
gctttggctgcatataaaggaaacggtcctgacctgatttatttgccggaaattcctttc
agcattgaaaagttcctcgatgatgtaaacagagtatataaagcaaacggtaaagttatc
gttgccgtatctgaaggttgtaaagatgaacaaggcagatatattgccgaaatgggtgca
actcttgcaaaagattccttcggtcatgctcaattgggtggtgccgcatcaatacttgca
aacatcgtaaaagaaagactgggcacaaaagtaagaggaatcgagttcagcctgcttcaa
agatgtgcagctcatattgcttcattgacagacgttaacgaagcatatatggctggacaa
atggctgttagaaatgctgttgaaggtaaaacagactacatggtcgctttcgaaagaccg
gaaggacctgaatacaagtgcaacatcaagctcattaaccttacagacgttgctaatacc
gaaaagaaaattccattagaatggatcaataaggaaggcaacggcttgacagaagacttc
attaaatatgcacttcctttgattcaaggtgaatccaaacctgtattggaagacgggctt
ccaagatttgcaaaattaaagaaagttcttgctacaaaataa

DBGET integrated database retrieval system