KEGG   Clostridium clariflavum DSM 19732: Clocl_3394Help
Entry
Clocl_3394        CDS       T01661                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ccl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3994937..3996955
Genome map
AA seq 672 aa AA seqDB search
MTNALNPQTKLKILELDPWLEPYRYDLEERMRRYYCVKKALLGEVQSLKDFANGHHYFGF
HQTEDGWYYREWAPAADALFLIGDFNGWNRESHPLTRKANGVWEIFLPGKNTLPHKSLVK
VHVKSQGREFDRIPLYIRRVVQDPENHNFNGQIWAPEKPFEWTDSDFRVDVTKPPLIYET
HIGMAQEKCGIGTYKEFEENILPRVKELGYNTIQIMAIMEHAYYGSFGYHVTNFFAASSW
FGTPEDLKSLINKAHEMGIAVLMDLVHSHAAKNTAEGINEFDGTDYQFFHSGGLGNHDVW
DSKLFNYGKHEVMHFLLSNIKFWIEEYHFDGFRFDGVTSMIYHDHGLGTAFDHYNKYFSM
NTHVEAVTYLQLANELIKDIKPNSITIAEDMSGMPGMCLPIEYGGIGFDYRLAMGMPDFW
VNTLKRNDHDWDMQALYHELSTCRYMEKRIAYVESHDQALVGDKTFIFRMADKEMYWHMN
KGSQNLEIERAVALHKMARLITISLGAEGYLNFMGNEFGHPEWIDFPREGNNWSFKHCRR
MWSLADSDYLRYYDLNQFDKAMIHFMSDEGLMGCTPQCLWIDQDRKLIAYRKKDFIFIFN
FHPTQSYPDFEIPIHQDAKFKVVLDTDDPKFGGHGRISHDVIYETHRLKMNNDFNGITIY
SPTRTAMVLKKV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgctttaaacccgcaaaccaaactcaagattttagaactcgatccttggttg
gaaccttacaggtacgacctggaagaaagaatgagacgctattattgtgttaaaaaagct
cttcttggtgaagttcaaagtcttaaagattttgcaaacggtcatcattatttcggtttc
catcaaacagaggacggatggtattatcgtgaatgggcccctgcagcagatgctttgttc
ctaattggtgactttaacggatggaaccgtgaatcccatcctcttacacgaaaagccaac
ggtgtttgggaaatattccttccgggcaaaaacacactgccccacaaatcccttgtcaaa
gtacatgtaaaaagtcaggggcgtgaatttgaccgtattcctttgtatataagaagagta
gtacaggatcccgaaaatcataatttcaacggacagatttgggcaccggaaaaacctttt
gaatggaccgattccgatttccgtgtcgatgtcacaaaaccaccgttgatctatgaaacc
catataggtatggcacaagaaaagtgcggtataggtacttataaagaattcgaggaaaac
atactgcccagagtaaaagaattgggctataacaccatccagataatggctattatggaa
cacgcttattatggttccttcggataccatgtcaccaacttttttgctgcctcttcatgg
tttggaactcctgaggatctaaaatccttaatcaataaagctcatgagatgggcatagcc
gtccttatggaccttgttcactcccacgctgcaaaaaatactgcagagggtataaatgaa
ttcgacggtactgattaccagttcttccacagtggaggtctgggcaatcacgacgtatgg
gattccaaactctttaactatggcaagcatgaagtaatgcactttttattatccaacata
aaattctggattgaggaatatcactttgacggtttccgctttgacggagtaacttccatg
atttatcacgaccatggtttgggaaccgcctttgaccactataacaaatacttcagcatg
aatacccatgttgaagcggtaacttatcttcagttggccaatgaacttataaaagatata
aaacccaattcaattaccattgcagaagatatgagcggtatgccgggaatgtgtcttccc
attgaatatggcggaataggcttcgattacagattggccatgggaatgcccgatttttgg
gtcaatacattaaaacgtaatgaccacgactgggatatgcaagcattataccatgaactg
tccacatgccgttacatggaaaagcgtatagcctatgtggaatcccacgaccaggccttg
gttggcgataaaacctttattttcagaatggctgacaaggaaatgtactggcatatgaac
aaaggaagccagaacttggaaatagagcgggcagtagctttgcacaagatggccagacta
attaccatttcccttggtgcggaaggttatttgaatttcatgggtaacgaatttggccac
cccgaatggattgacttcccgcgtgaaggcaacaattggagtttcaagcactgcagaaga
atgtggtcccttgctgacagtgattacctcaggtattacgacttgaatcaatttgacaag
gcaatgatccatttcatgtccgatgaaggtcttatgggctgtacacctcaatgtttatgg
atagatcaggacaggaaattaattgcctatagaaaaaaagattttatattcatattcaat
ttccatcccacccagtcatatcctgattttgaaataccaattcatcaggatgccaaattt
aaggtggttcttgataccgatgacccgaaattcggtggacatggtcgcatctcacacgat
gtgatttatgaaactcataggctaaagatgaataatgactttaacggaattaccatatac
tctcccactcgtacggcaatggttttaaaaaaagtgtag

DBGET integrated database retrieval system