KEGG   Clostridium clariflavum: Clocl_3587Help
Entry
Clocl_3587        CDS       T01661                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ccl  Clostridium clariflavum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Clocl_3587
Enzymes [BR:ccl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Clocl_3587
Exosome [BR:ccl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Clocl_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4214929..4215909)
Genome map
AA seq 326 aa AA seqDB search
MNAIRPRRLRNDKNIRDLARETRISSKALILPLFIKEGNGIIEPIESLEGHNYYSPDTVQ
AGIEDILNANVKSVLLFGIPDKKDDEGSGAYSEDGVVQKAVRKIKERYPEITVITDVCMC
EYTANGHCGIVKDGKVINDLTLPYIAKIALSHVEAGADIVAPSDMMDNRVAEIRKTLEGK
GFHDTPIMSYSVKYASSFYGPFRDVAKSAPAFGDRKTYQMDYHNRREALKEAMLDIQEGA
DILMVKPAMAYLDIIRELKDKTQNPICAYSVSGEYAMIKSAAKLGLVNEYAVMCESAVSM
FRAGADMLITYYAKELSKAIEKGDIG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaatacggccacgaagactgagaaatgataaaaacataagggatttggcaaga
gaaacaaggatttcatccaaagcattaatacttccattgttcataaaggaagggaacgga
attatcgagcccatagaatctttagagggacataactattacagccccgataccgtacag
gcagggatagaagatattcttaatgccaacgttaaatcggttttgcttttcggtattccc
gataaaaaagatgatgaagggagcggagcttatagcgaagacggagtcgtacaaaaagcc
gtaaggaaaatcaaggaaaggtatccggaaataactgtaataacagatgtctgtatgtgc
gaatatacggcaaacggacactgcggcatagtgaaggacggcaaggtcataaatgacctg
acgcttccctacattgctaaaatcgctctttcccatgttgaagccggggctgatattgtc
gctccgtcagacatgatggacaacagggttgcagaaataaggaaaacccttgagggcaaa
ggctttcatgatactccaatcatgtcgtattcagtaaaatatgcttcgtcgttttacgga
ccgttcagagatgtggccaaatctgctccagcctttggggacagaaagacataccagatg
gattatcacaacaggcgtgaagctttaaaggaagccatgctggatattcaggagggtgcg
gatattttgatggtaaagccggccatggcttatcttgacattataagagagcttaaggat
aaaacacaaaaccccatttgcgcatacagcgtaagcggtgagtacgcaatgataaaaagc
gctgccaagttgggccttgttaatgaatatgctgttatgtgcgaaagtgccgtcagtatg
ttcagagcaggtgcggacatgcttataacgtactatgcaaaggaattatcaaaagcaatt
gagaagggagatatcggatga

DBGET integrated database retrieval system