KEGG   Clostridium clariflavum: Clocl_3860Help
Entry
Clocl_3860        CDS       T01661                                 

Definition
(GenBank) ROK family protein, putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00010  Glycolysis / Gluconeogenesis
ccl00052  Galactose metabolism
ccl00500  Starch and sucrose metabolism
ccl00520  Amino sugar and nucleotide sugar metabolism
ccl00521  Streptomycin biosynthesis
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01120  Microbial metabolism in diverse environments
ccl01130  Biosynthesis of antibiotics
ccl01200  Carbon metabolism
Module
ccl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clocl_3860
   00052 Galactose metabolism
    Clocl_3860
   00500 Starch and sucrose metabolism
    Clocl_3860
   00520 Amino sugar and nucleotide sugar metabolism
    Clocl_3860
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Clocl_3860
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Clocl_3860
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Clocl_3860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110 Chorein_N
Motif
Other DBs
NCBI-ProteinID: AEV70308
UniProt: G8M2D8
Position
complement(4481276..4482220)
Genome map
AA seq 314 aa AA seqDB search
MYSVGIDLGGTNIAAGLVDQDGKILYKESVPTNAQRPYTEIIKDMAELSYNVIKGANVKI
DEVQKIGIGSPGTPNCKEGILIFSGNLNFRNVPIKAEMQKYINLPVYLDNDANCAALAES
VAGSAKGAKHSVTITLGTGIGGGIIIDGKIYSGFNYAGAEIGHMVIHCDGVQCTCGRKGC
WETYASATALIRQTTKAAQENPDSIINQLVDGDLSKINAKTPFDAAKQGDEVGNRVVKQY
IKYIAEGLINVINIFMPEVVVIGGGVCKEGEYLLKPLRELVYAGVFSREEIPQTQIKTAQ
MGNDAGIIGAAMLG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtattctgtgggtattgatcttgggggaacaaatatagcagcaggattggttgatcag
gatgggaaaatattgtataaggaaagcgtaccgactaatgcgcagaggccttatacggaa
ataataaaagatatggcagagctttcttataacgtgatcaaaggtgcaaatgtaaaaata
gatgaggtacaaaaaatagggataggaagccccggtactccgaactgtaaagaaggaatt
ctaatttttagcggtaacctgaatttcagaaacgttcctataaaagcagaaatgcagaag
tacattaatctgcctgtatatcttgataacgatgcaaattgtgcagctttggctgaaagc
gttgcagggagtgcaaaaggtgcgaaacattcggttaccattactttgggaacaggtata
ggcggaggaataattattgacggtaaaatttacagtggatttaactatgctggtgcggaa
ataggccatatggttatacactgtgatggggtacagtgtacctgtggcaggaaaggctgt
tgggagacctatgcctctgctactgctttaataaggcaaacgacaaaagctgcacaggaa
aatcccgattcgataatcaaccagctggttgatggagatttaagcaaaataaatgccaaa
acgccttttgatgcagcaaagcaaggggatgaagtaggtaatagggttgttaaacaatat
ataaaatatatagctgagggactgataaatgttataaatatatttatgccggaagtagta
gtaattggcggcggagtttgcaaagaaggtgaatatctgcttaagccactgagagaattg
gtttatgccggggtcttcagcagggaagaaataccgcagacacaaataaagacagctcaa
atgggtaatgatgccggaataatcggtgcagctatgctgggatag

DBGET integrated database retrieval system