KEGG   Clostridium clariflavum: Clocl_3929Help
Entry
Clocl_3929        CDS       T01661                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00340  Histidine metabolism
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
ccl01230  Biosynthesis of amino acids
Module
ccl_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Clocl_3929
Enzymes [BR:ccl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Clocl_3929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh SIP RE_HindVP
Motif
Other DBs
NCBI-ProteinID: AEV70369
UniProt: G8M2J9
Position
complement(4545220..4546512)
Genome map
AA seq 430 aa AA seqDB search
MIQFIDLRANKDSDIFNKLASRNQIEYGDIQDRVSDIVNNVKKNGDNAVFEYTALFDKVE
LTSDNLKVSPDEIEKAYGKVGKELIEVIKKARNNIAKFHEKQLEKSWFTTGEDGVILGQL
YNPIEVVGIYTPGGTAAYPSSVLMNAVPAKVAGVKRIVMVTPPGGTDGINPAILVAANEA
GVDEIYKIGGAQAIAALAFGTESIPKVDKIVGPGNIYVALAKRMVYGYCDIDMIAGPSEI
MVVADETANPKYAAADMLSQAEHDALASAILVTTSEKITEEVKRELEIQLNKLPRKEIAE
KSLKDFGAIILVDDIDSAVDVVNRIAPEHLELCVSEPFSLISYIKNAGAIFLGNYSSEPL
GDYYAGPNHVLPTSGTARFFSPLNVSEFMKKSSIISYSKKALQQVKDDVIKFAEAEGLKA
HANAIRVRFE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatacagtttatagatttgagagcaaacaaagacagcgatattttcaacaagcttgca
tccagaaaccagattgaatatggagatatacaggacagggtttcagatattgtcaacaac
gttaaaaagaatggagataatgctgtttttgagtatactgccctgtttgacaaggttgag
cttacttcagataatttgaaagtttctcctgatgagatagaaaaagcttatggaaaagta
ggcaaggaacttatagaggtaattaaaaaggccagaaataatatagcaaagttccatgaa
aaacagttggaaaagtcatggtttacaacgggtgaagatggtgttatattagggcaactt
tataatcccattgaagtagttggtatctatactccaggcggaactgcagcatatccttca
tcggttcttatgaatgctgttccggctaaggttgcaggggtaaagaggattgtaatggtt
actcccccgggaggaactgacggaatcaatcctgccatcctggtggcagctaatgaggct
ggtgtagacgagatatataaaattggcggtgcacaggcaattgcggcacttgcttttgga
acagagtccattcctaaagtagacaagatcgtaggccctgggaatatatatgttgcattg
gcaaaaaggatggtctatggatattgtgatatagatatgattgcaggaccaagcgaaata
atggttgttgccgatgaaacggcaaatccaaagtatgcagccgcggatatgctttcacag
gctgagcacgatgcacttgcttcggctattttagtaactacgtcggaaaagataactgaa
gaggtaaagcgagaattggaaatacagcttaataaactgccgaggaaagaaatagctgag
aagtccttgaaagactttggcgcaattatactggttgacgacatagatagtgctgtcgat
gttgtaaacaggattgcaccggagcatctcgaactatgtgtgagtgaacctttcagtctc
attagttatataaaaaatgccggggcgattttcttggggaattactcctcggaaccattg
ggagactattatgcaggacctaaccatgttttgcctacaagtggaacggcaaggtttttc
tcaccgctgaatgtttcggaatttatgaaaaaatcaagtattatatcctactcaaaaaag
gctttgcagcaggtaaaagatgatgtgataaagttcgctgaggcagaggggcttaaagcg
catgccaacgctattagagtgaggtttgaataa

DBGET integrated database retrieval system