KEGG   Clostridium clariflavum DSM 19732: Clocl_4052Help
Entry
Clocl_4052        CDS       T01661                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ccl  Clostridium clariflavum DSM 19732
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4689610..4690173)
Genome map
AA seq 187 aa AA seqDB search
MVDKERIKAAVKEILIAIGENPDREGLVETPDRVARMYEEIFAGLHQDPKEVVKVFQEEN
HEEMVMVKDIPLYSMCEHHLVPFVGVAHVVYIPKKGKIMGLSKLARIVDLLAKKPQLQER
LTSEVANVIMETIDPLGVAVVVEAEHLCMTMRGIKKPGSKTVTSALRGIIKTDARTRAEV
MSLINRK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttgataaagagcgtattaaagcagcggtaaaggaaattcttattgcaattggagaa
aatcctgaccgtgaaggacttgttgagacaccggacagggtggcacgtatgtatgaggaa
atatttgccgggcttcatcaggaccctaaagaagtagttaaggtatttcaggaggaaaac
catgaggaaatggttatggtaaaggatattcccctttattctatgtgcgaacatcatttg
gtgccttttgtaggagtggcgcatgtggtatatatacctaaaaagggtaaaataatggga
ctcagcaaattggcgagaattgtggatttactggcaaaaaagcctcaattgcaggaacgt
ttaaccagtgaggttgcaaatgttataatggaaaccatcgaccctctaggagttgctgta
gttgttgaagcggaacatttgtgtatgacaatgcgaggtataaagaaacctggatcaaag
actgttacttccgcccttaggggcataataaagactgatgccagaaccagagcggaggtt
atgtcattaattaaccgcaagtaa

DBGET integrated database retrieval system