KEGG   Clostridium clariflavum: Clocl_4130Help
Entry
Clocl_4130        CDS       T01661                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00040  Pentose and glucuronate interconversions
ccl00052  Galactose metabolism
ccl00500  Starch and sucrose metabolism
ccl00520  Amino sugar and nucleotide sugar metabolism
ccl01100  Metabolic pathways
ccl01130  Biosynthesis of antibiotics
Module
ccl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clocl_4130
   00052 Galactose metabolism
    Clocl_4130
   00500 Starch and sucrose metabolism
    Clocl_4130
   00520 Amino sugar and nucleotide sugar metabolism
    Clocl_4130
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clocl_4130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD DRAT
Motif
Other DBs
NCBI-ProteinID: AEV70561
UniProt: G8LTQ1
Position
complement(4769491..4770363)
Genome map
AA seq 290 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAINSGIEDIIIISGRNK
RAIEDHFDKSYELEHELAKKGDEELLELVRGISNLANIHYIRQKEAKGLGHAIYCAKSFI
GNEPFAVLLGDDIVDSEVPCLKQLIDVFNEYKTTVLGVQPVDEEDVSKYGIVSCKQVDNR
VYKVKDLVEKPDKENAPSNIAILGRYIITPLIFECLENAKPGKGGEIQLTDALKTLIGQE
AMYAYDFIGKRYDVGNKLGFLQATVEFALKREDLNEEFTKYLRNIICDIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtacgtaaggcaataattccagcagcaggcctgggaacaagatttttacctgca
acaaaagctcagccaaaggaaatgttacccatagtcgataagccaacaattcagtacata
gtcgaagaagcgattaattccggtattgaagacataatcattatatctggtagaaacaag
agggcaattgaagaccatttcgataagtcctatgagcttgagcatgaacttgcaaaaaag
ggagatgaagaactccttgaactggtaagaggaatatcaaatcttgcaaatattcattat
atacgtcagaaagaagcgaaagggttgggacatgctatatattgcgcaaaatcctttatt
ggtaacgagccctttgcagtattgctcggagacgatatagtggactcagaggttccatgt
cttaagcaacttatagatgtatttaatgagtataaaaccacagtattaggagttcagcct
gttgatgaagaagatgtatcgaaatatggaattgtaagttgcaaacaggttgataataga
gtttataaagtcaaagaccttgttgaaaagccggacaaagagaatgcgccatcaaatatt
gccattttgggaagatatattattacaccgctaatatttgaatgtcttgagaacgcaaaa
ccaggaaaaggcggagaaatacaattgaccgatgcgctaaaaactttgattggccaggaa
gctatgtatgcctatgactttatcggaaaaagatatgatgttggaaacaagcttggtttt
ttacaagcaacagtggagttcgctttaaagagagaagatcttaatgaagagtttacgaaa
tatttaagaaatataatttgtgatatcaaataa

DBGET integrated database retrieval system