KEGG   Clostridium clariflavum: Clocl_4130Help
Entry
Clocl_4130        CDS       T01661                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccl  Clostridium clariflavum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clocl_4130
   00052 Galactose metabolism
    Clocl_4130
   00500 Starch and sucrose metabolism
    Clocl_4130
   00520 Amino sugar and nucleotide sugar metabolism
    Clocl_4130
Enzymes [BR:ccl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clocl_4130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4769491..4770363)
Genome map
AA seq 290 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAINSGIEDIIIISGRNK
RAIEDHFDKSYELEHELAKKGDEELLELVRGISNLANIHYIRQKEAKGLGHAIYCAKSFI
GNEPFAVLLGDDIVDSEVPCLKQLIDVFNEYKTTVLGVQPVDEEDVSKYGIVSCKQVDNR
VYKVKDLVEKPDKENAPSNIAILGRYIITPLIFECLENAKPGKGGEIQLTDALKTLIGQE
AMYAYDFIGKRYDVGNKLGFLQATVEFALKREDLNEEFTKYLRNIICDIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtacgtaaggcaataattccagcagcaggcctgggaacaagatttttacctgca
acaaaagctcagccaaaggaaatgttacccatagtcgataagccaacaattcagtacata
gtcgaagaagcgattaattccggtattgaagacataatcattatatctggtagaaacaag
agggcaattgaagaccatttcgataagtcctatgagcttgagcatgaacttgcaaaaaag
ggagatgaagaactccttgaactggtaagaggaatatcaaatcttgcaaatattcattat
atacgtcagaaagaagcgaaagggttgggacatgctatatattgcgcaaaatcctttatt
ggtaacgagccctttgcagtattgctcggagacgatatagtggactcagaggttccatgt
cttaagcaacttatagatgtatttaatgagtataaaaccacagtattaggagttcagcct
gttgatgaagaagatgtatcgaaatatggaattgtaagttgcaaacaggttgataataga
gtttataaagtcaaagaccttgttgaaaagccggacaaagagaatgcgccatcaaatatt
gccattttgggaagatatattattacaccgctaatatttgaatgtcttgagaacgcaaaa
ccaggaaaaggcggagaaatacaattgaccgatgcgctaaaaactttgattggccaggaa
gctatgtatgcctatgactttatcggaaaaagatatgatgttggaaacaagcttggtttt
ttacaagcaacagtggagttcgctttaaagagagaagatcttaatgaagagtttacgaaa
tatttaagaaatataatttgtgatatcaaataa

DBGET integrated database retrieval system