KEGG   Capnocytophaga canimorsus: Ccan_01170Help
Entry
Ccan_01170        CDS       T01582                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ccm  Capnocytophaga canimorsus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ccan_01170
   00670 One carbon pool by folate
    Ccan_01170
Enzymes [BR:ccm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Ccan_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
136499..136987
Genome map
AA seq 162 aa AA seqDB search
MITLIAAASQNNALGKNGDLLWHLPKDFTHFKNLTMGHCIVMGRKTFETFPKLLPGRKHI
IITRQKEYQKADCIVVPSVEWAIEMALQIDENPFIIGGGEVYRQTMKYAQKIELTRVHAH
FEEADAFFPEISDKEWQLVESVTCLKDDKHAYDFTFETYLRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgataacactcattgcagcggcttcacaaaacaatgcgctgggcaaaaacggagattta
ctatggcatttgcccaaggattttactcattttaaaaaccttacgatggggcattgcatc
gtgatggggcgcaaaacctttgaaacttttcccaagttactccctggtagaaagcatatt
atcataactcggcaaaaagagtatcaaaaagcggattgtattgtagtgccttcggttgaa
tgggctattgaaatggctttacaaatagatgaaaatccgtttattatcggaggaggggaa
gtttatcgccaaacgatgaaatacgctcaaaaaattgaacttacccgagttcacgcccat
tttgaagaggctgatgcttttttcccagaaatatcagacaaggaatggcaattggtagag
tccgtaacttgtttgaaagatgataaacacgcttatgattttactttcgaaacttatctt
cgtaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system