KEGG   Capnocytophaga canimorsus: Ccan_01940Help
Entry
Ccan_01940        CDS       T01582                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex component E2
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00020  Citrate cycle (TCA cycle)
ccm00310  Lysine degradation
ccm01100  Metabolic pathways
ccm01110  Biosynthesis of secondary metabolites
ccm01120  Microbial metabolism in diverse environments
ccm01130  Biosynthesis of antibiotics
ccm01200  Carbon metabolism
Module
ccm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ccan_01940
  Amino acid metabolism
   00310 Lysine degradation
    Ccan_01940
Enzymes [BR:ccm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ccan_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H DUF2190
Motif
Other DBs
NCBI-ProteinID: AEK22316
UniProt: F9YQE8
Position
complement(211777..213000)
Genome map
AA seq 407 aa AA seqDB search
MILEMKVPSPGESITEVEIARWLVKTGDYVEKNQTIAEVDSDKATLELPAEASGVITLQA
EEGDAVAVGQVVCLIDTSAEKTTTAAPTKEQPKVETPKPDVVKTAPAQAEPQPTYASNTP
SPAAKKILAEKNISNQEVKGTGKAGRITKADALTASKPAMGTPSGGNRAETRTKMSMLRR
KVAERLVSAKNETAMLTTFNEVDMSAIFQLRNQYKDAFKDKHNVGLGFMSFFTLAVVRAL
KLFPDVNSMIDGQDKVTYNFYDISIAVSGPKGLMVPVIRNAENLSFRGVEAEVKRLALRA
RDGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIVERPVVKNGQIVVAP
VMYVALSYDHRIIDGRESVGFLVAVKEALENPVELLMNGDVKSALEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgaaatgaaggttccctcaccgggagagtctataaccgaagttgaaattgct
cgttggttagttaaaacgggggattacgtggaaaaaaaccaaaccattgctgaggtagat
tctgataaagctacccttgaacttcccgctgaagccagtggtgtgataacattacaagcc
gaagaaggcgatgctgttgctgtggggcaggtggtttgcttgattgatacttcagctgaa
aaaacaaccacagcagctcctacaaaagaacaaccaaaagttgaaacccctaaaccagat
gtcgtaaaaacagctccagcacaggcagaaccccaacctacttatgcctctaatacgccg
agccctgcggctaaaaaaatccttgcagaaaaaaatatttcaaatcaagaagttaaaggt
actggaaaagcaggacgcatcacgaaagccgatgcattaacagcatcaaaacctgctatg
ggaacgccctcaggtggaaatcgtgcagaaacacgcaccaaaatgtctatgcttcgccga
aaagtagccgaacgtttagttagcgctaaaaatgaaacagctatgcttaccactttcaat
gaagtggatatgagtgctatttttcagcttagaaatcagtataaagacgcctttaaggac
aagcacaacgttggcttgggctttatgtcattctttaccttagccgtagttcgtgcactt
aagcttttcccagatgttaattcaatgattgacggtcaagataaagttacgtataatttt
tacgacatttctattgcggtttcgggacctaaagggcttatggtacccgtgatacgaaat
gctgaaaatttatcattccgaggggttgaggctgaagtaaaacgcttagcattacgcgct
cgtgatgggcaaattaccgttgatgaaatgacaggaggaacttttaccattaccaatgga
ggagtttttgggtcaatgctttccacgcctatcattaatccaccacaatctgggatttta
ggaatgcacaacattgttgagcgtccagtggttaaaaacggacagatagttgtcgctcca
gtgatgtatgtagcgctatcttatgatcatcgtatcattgacggacgagaatccgtagga
tttttggtagccgttaaagaggctttggaaaatccagtagaattattgatgaacggcgat
gtaaaatcggctttggaattgtaa

DBGET integrated database retrieval system