KEGG   Capnocytophaga canimorsus: Ccan_01940Help
Entry
Ccan_01940        CDS       T01582                                 

Definition
2-oxoglutarate dehydrogenase complex component E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccm  Capnocytophaga canimorsus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccan_01940
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ccan_01940
  Amino acid metabolism
   00310 Lysine degradation
    Ccan_01940
Enzymes [BR:ccm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ccan_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(211777..213000)
Genome map
AA seq 407 aa AA seqDB search
MILEMKVPSPGESITEVEIARWLVKTGDYVEKNQTIAEVDSDKATLELPAEASGVITLQA
EEGDAVAVGQVVCLIDTSAEKTTTAAPTKEQPKVETPKPDVVKTAPAQAEPQPTYASNTP
SPAAKKILAEKNISNQEVKGTGKAGRITKADALTASKPAMGTPSGGNRAETRTKMSMLRR
KVAERLVSAKNETAMLTTFNEVDMSAIFQLRNQYKDAFKDKHNVGLGFMSFFTLAVVRAL
KLFPDVNSMIDGQDKVTYNFYDISIAVSGPKGLMVPVIRNAENLSFRGVEAEVKRLALRA
RDGQITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIVERPVVKNGQIVVAP
VMYVALSYDHRIIDGRESVGFLVAVKEALENPVELLMNGDVKSALEL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgaaatgaaggttccctcaccgggagagtctataaccgaagttgaaattgct
cgttggttagttaaaacgggggattacgtggaaaaaaaccaaaccattgctgaggtagat
tctgataaagctacccttgaacttcccgctgaagccagtggtgtgataacattacaagcc
gaagaaggcgatgctgttgctgtggggcaggtggtttgcttgattgatacttcagctgaa
aaaacaaccacagcagctcctacaaaagaacaaccaaaagttgaaacccctaaaccagat
gtcgtaaaaacagctccagcacaggcagaaccccaacctacttatgcctctaatacgccg
agccctgcggctaaaaaaatccttgcagaaaaaaatatttcaaatcaagaagttaaaggt
actggaaaagcaggacgcatcacgaaagccgatgcattaacagcatcaaaacctgctatg
ggaacgccctcaggtggaaatcgtgcagaaacacgcaccaaaatgtctatgcttcgccga
aaagtagccgaacgtttagttagcgctaaaaatgaaacagctatgcttaccactttcaat
gaagtggatatgagtgctatttttcagcttagaaatcagtataaagacgcctttaaggac
aagcacaacgttggcttgggctttatgtcattctttaccttagccgtagttcgtgcactt
aagcttttcccagatgttaattcaatgattgacggtcaagataaagttacgtataatttt
tacgacatttctattgcggtttcgggacctaaagggcttatggtacccgtgatacgaaat
gctgaaaatttatcattccgaggggttgaggctgaagtaaaacgcttagcattacgcgct
cgtgatgggcaaattaccgttgatgaaatgacaggaggaacttttaccattaccaatgga
ggagtttttgggtcaatgctttccacgcctatcattaatccaccacaatctgggatttta
ggaatgcacaacattgttgagcgtccagtggttaaaaacggacagatagttgtcgctcca
gtgatgtatgtagcgctatcttatgatcatcgtatcattgacggacgagaatccgtagga
tttttggtagccgttaaagaggctttggaaaatccagtagaattattgatgaacggcgat
gtaaaatcggctttggaattgtaa

DBGET integrated database retrieval system